CAZyme Information: MGYG000000200_02101

Basic Information

• Species: Blautia_A sp003471165
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia_A; Blautia_A sp003471165
• CAZyme ID: MGYG000000200_02101
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
346	MGYG000000200_13|CGC1	39938.08	8.374

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000200	4192583	Isolate	China	Asia

• Gene Location: Start: 84391; End: 85431 Strand: +

Full Sequence      

MTDNIDKYNKGNATVKNGADDQKSDKTDNLENNIEDNERKMVDVIIPTYRPAKEFGELLH
RLEKQEYRPNRILVMNTGKEYWNSEWENYPLLEVHHLDQKDFDHGGTRKRAAELSTADIM
VFMTQDALPADRKMIGNLVRAVSRNSGTGAAYARQLPNADCRFLERYTRSFNYPEQSSVK
SLSDVETYGIKTYFCSNVCAAYDREIYQKIGGFVNRAIFNEDMIYAGTMVQQGYSVAYTA
DAKVYHSHNYSGKQQFHRNFDLGVSQAEHPEIFEGVPSEGEGIRLVKKSLNYLLRTGHIW
LIPQLIWQSGMKYAGYFLGKRYKKLPQKVILACTMSPYYWKKKDSE

Enzyme Prediction     

No EC number prediction in MGYG000000200_02101.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06423	CESA_like	1.40e-09	44	218	1	177	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	1.69e-09	36	245	50	263	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
pfam00535	Glycos_transf_2	3.50e-09	43	207	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG1216	GT2	2.77e-08	39	329	2	287	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
COG0463	WcaA	3.10e-08	38	258	1	211	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCU01338.1	4.59e-160	43	342	7	307
CBL24569.1	3.47e-147	38	341	2	306
CBK76837.1	1.66e-128	39	340	26	335
QNM10252.1	1.08e-126	42	341	6	305
QUO22269.1	1.03e-120	39	345	2	308

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26403	2.98e-63	42	340	3	302	O antigen biosynthesis rhamnosyltransferase RfbN OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfbN PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000200_02101.