CAZyme Information: MGYG000000202_00304

Basic Information

• Species: AF33-28 sp003477885
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; AF33-28; AF33-28 sp003477885
• CAZyme ID: MGYG000000202_00304
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1144	MGYG000000202_1|CGC10	130228.87	5.1316

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000202	5162288	Isolate	China	Asia

• Gene Location: Start: 374701; End: 378135 Strand: -

Full Sequence      

MEFVLNSQETVGVGLSENESEAVKTAFFNLKTDLSRAVGIHCTDAGADSRILVGTVGVSE
LTAPYVDADRLKDEQGRLRREAYMLKVCGNRLVIAGTDRRGTIYGIYDLCERIGVSPWHY
FADVPVKVKEQFALEDGFEVIDYPSVEYRGIFINDEEELDCWARLHMDEDTIGVHTYEKI
FELILRLKGNYIWPAMHVNSFNLKVENGALADRMGLVVGTSHCDMLMRSNNREWIPWITK
KGYDDAVYDYSVEGRNRDILKEYWRESVEQNRDFEVSYTLGMRGIHDSGFETRALKAESK
EEMRRKKVALLQKVIGDQKEILADTLGRDTLKLFVPYKEVLDLYDNGLDVPEDITLIWSN
DNYGYVRRYPSEKEQRRSGGNGIYYHNSYWSPPGRSYLFICSIPLAQTKYELEKAYENGI
QKLWVMNVGALKPLEQEMEYYLRLAWEIGKENGSTSDVDAWLAGWIDRNFSGGHGDEMAG
ILNDFTQLTNVRKIENLDNDTFSQTAYGDEGAVRLNRYKEMYDRANAIYESLPENEKPAF
FQMALMKIHAAYYTNAQYYFADRSTLCVNQGKMQAAARYTEYSRFYDDQRRRMLKYYNEE
MLGGKWRGMVTPEDFPPPRTAMHPACTPPLSIGGRKMLITLWNGDSELRFTKPATKWFEI
ANAGAGEFTFEAEADDWMKLSETRGTVRGEIRILVTVEDTAASRKGRIQVRNRTDQTVTC
IDVTVQSLTELLSAADSAANCSSRSLGEIPPDIAAICEDDGIVAVRADSRQAPGWRHIKR
LGRGGGDLVEAYEQGSPLSYPILLTEDAADSLLEIHRYPSLNSTGRIRMGVSVDEGTPQT
VESESNDEWRGQWTVNTMDHVDKLYLHLPAMKRGMHTVTFTAVDRYFAFTKFVLYCRPRK
YNSLGTTEGSQALPDEKFIKEASNIWYGTLPLKPRPMLYADRVFAGNTLLANDLIAEQEE
YGTARSPYELLQGGMSVYPEKDGQVRIDAVAAYAQTPYAYTEHYTWQYCSSESYGRSGLA
MYIRRQGLKWDSTEAAPSLNYRLSCDGGDYTVWMLAKFNSNEDSCISAAIDHAVLPKEAL
YRGGRLWRYEAEQVWRWIPAAVCHMDAGGHLLTVYCLASGLRIDRICLTKGDSIPPLDKD
WRLR

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	7	887	6.1e-186	0.9799139167862266

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	4.65e-141	142	495	1	333	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	8.97e-14	758	908	4	172	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam03648	Glyco_hydro_67N	1.14e-04	17	109	27	120	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).
pfam17829	GH115_C	0.002	977	1131	1	161	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
cd14948	BACON	0.003	661	719	13	79	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOV19968.1	0.0	1	1141	2	1120
AIQ48273.1	0.0	4	1142	3	1201
AIQ53763.1	0.0	4	1142	3	1201
AIQ31286.1	0.0	10	1142	11	1202
AJE49570.1	0.0	4	1141	13	1207

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5BY3_A	6.68e-93	2	562	19	577	Anovel family GH115 4-O-Methyl-alpha-glucuronidase, BtGH115A, with specificity for decorated arabinogalactans [Bacteroides thetaiotaomicron VPI-5482]
4ZMH_A	5.78e-89	18	701	30	746	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
7PUG_A	1.78e-82	15	611	30	626	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	4.85e-80	15	611	29	625	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
4C90_A	6.79e-76	15	610	57	640	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000202_00304.