CAZyme Information: MGYG000000202_00412

Basic Information

• Species: AF33-28 sp003477885
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; AF33-28; AF33-28 sp003477885
• CAZyme ID: MGYG000000202_00412
• CAZy Family: GH140
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
405	MGYG000000202_1|CGC15	46721.86	6.3182

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000202	5162288	Isolate	China	Asia

• Gene Location: Start: 505014; End: 506231 Strand: -

Full Sequence      

MAEEIRFPIRISENGVFFEDQDGKPFLWHADTCWRLFWMMSYEEACFYLRDRAEKGFTVI
QVHLLPHHVYQTNVYGENPFTAPGMIDSLNEEYFFNVDRVIAYAGSLGLAVAVAPMWLST
WEDDWHRLYRGEPLDRYARQIAQRYGKFSNVIAFIHGGDDDAVPLHDEVNRCVPIYKKYA
KHVLNTFHAGIGPSYPMFGEKSWYDFCMNYTYDYGRCIEQMLDAKKKYPHKPAVLGETHY
DGNDGISSTEIRRYAYTSVILGGAGQTYGNKDIWMANMFWKDALYTAAAHHMTVLREVFE
HIPWYRLIPDAEGTLFHTVRALMPNASDSYIPAASVRGGMEIVAYVSDRRFFTIRRDGCY
AGEWIDPVRGRSFRLTGKTGDILHIPGHNAGGSDDWILHAIFEDR

Enzyme Prediction     

No EC number prediction in MGYG000000202_00412.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH140	9	374	1.4e-64	0.941747572815534

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13204	DUF4038	7.17e-65	14	300	1	318	Protein of unknown function (DUF4038). A family of putative cellulases.
pfam00150	Cellulase	0.008	20	152	2	124	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS96054.1	4.73e-115	7	398	17	410
AXE17228.1	7.75e-51	7	373	43	423
AYQ32443.1	1.55e-50	7	373	44	424
BBA73419.1	2.23e-49	6	398	26	426
QFP65018.1	8.50e-49	7	398	27	426

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MSY_A	8.67e-26	11	401	20	445	Glycosidehydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_B Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_C Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482]
3KZS_A	7.16e-23	11	401	20	445	Crystalstructure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_B Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_C Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_D Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482]
4QFU_A	8.69e-18	11	345	33	400	ChainA, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_B Chain B, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_C Chain C, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_D Chain D, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_E Chain E, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_F Chain F, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_G Chain G, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_H Chain H, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_I Chain I, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_J Chain J, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_K Chain K, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_L Chain L, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000202_00412.