CAZyme Information: MGYG000000202_01324

Basic Information

• Species: AF33-28 sp003477885
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; AF33-28; AF33-28 sp003477885
• CAZyme ID: MGYG000000202_01324
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
810		88009.74	5.1646

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000202	5162288	Isolate	China	Asia

• Gene Location: Start: 24742; End: 27174 Strand: +

Full Sequence      

MELYKDCSYSPEERADDLLNRLSLDEKMAQIAGLICRPVLTKEEAEPLRRMFPHGAGQVS
ALVMGGLHAVKDARKMQRILQTMVMEQSEHHIPAVFHLEGLSGAWVAGGMSFPSGIGRGA
SFDPELEEKVGAITARQELAVGITQILCPVLDIARDPRHGRHGEAYGEDPTLAAAMGSAN
VRGIQGQEVYGLHAEACAKHYMAYHMSAGGINSAHTQIGPRALREIHGKPFQAAIAKSEL
RAVMPCYNAVDDGPVSASPEFLTEILRGEMGFKGTVLSDYGAVSNVHTVHYVGETMEEAG
YRCLTAGMDVELPMPVAFGTGLKQMFAEGRADMAVLDRAVKRVLTEKFRMGLFEHPFGLE
EEAFDAVYQSEEDHRVSLQSARESLVLLKNNGVLPLKKKCKKAALIGPHANWANHYFGGY
SALSGAEASAAASNSQAGIAENDASNARGAVLIPGTQVQFSETEIFKQQLDWVKTDCPTL
LTCLQKALPDTEVVYAHGYQIVGDNRDEFAEALEVCKDADVILLTLGGKNGGGSVSTMGE
GVDSADINIAGCQDSFIREAAKLGHPMVGIHFDGRPVSSDAADQYLDAILEAWNPAEYAA
QAVTEVLCGQVNPSGKMPVTTARCAGQIPVYYNHPNGSSWHQGESCGFRNYVDIPHEPRY
YFGHGLSYTTFSYSNLKVNGSEQEAQPVSPKEKVMISCDITNTGKLAGTEIVQLYLKDTF
ASMLRPVQELQGFARVALEPGETKTVTFACAPSQMAFLTRDMRWKVEAGKIEVFIGASSV
DLRLQNSFIITEDDFPVGREREFWAEVQIV

Enzyme Prediction     

No EC number prediction in MGYG000000202_01324.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	85	313	2.3e-58	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	3.50e-121	16	788	39	762	beta-glucosidase BglX.
COG1472	BglX	3.71e-73	22	411	1	365	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	1.08e-58	23	345	1	315	Glycosyl hydrolase family 3 N terminal domain.
PLN03080	PLN03080	2.98e-50	6	752	44	744	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	3.53e-30	385	668	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF23793.1	3.02e-307	1	805	1	794
AHF25953.1	2.63e-303	1	805	1	794
VCV22852.1	1.61e-294	4	810	8	817
CBL11432.1	1.61e-294	4	810	8	817
AJG98232.1	5.83e-293	1	806	5	802

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Z87_A	5.48e-106	4	783	36	778	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5XXL_A	7.69e-98	16	783	15	745	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	4.05e-97	16	783	15	745	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5TF0_A	7.18e-89	16	783	14	744	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
6R5I_A	9.47e-88	112	779	88	722	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	4.40e-100	92	779	65	710	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
T2KMH9	3.94e-96	4	783	29	748	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
P33363	5.01e-94	2	783	22	758	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
Q56078	9.86e-93	10	788	30	762	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
A7LXU3	8.04e-86	69	782	101	768	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000202_01324.