CAZyme Information: MGYG000000202_01828

Basic Information

• Species: AF33-28 sp003477885
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; AF33-28; AF33-28 sp003477885
• CAZyme ID: MGYG000000202_01828
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
238	MGYG000000202_5|CGC3	27920.71	4.6921

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000202	5162288	Isolate	China	Asia

• Gene Location: Start: 218381; End: 219097 Strand: +

Full Sequence      

MLKILQMLKRYALSLDDTRPVSYAMNPHFKRESDVNLSAIKDIQQFVDEISDTEIYDNRE
RVERISGIAELVDIISCNYQEQWYSLIHEAVPDKLILGTELYQYFMGNGEQMQNFTEKNP
SLIPFEKPYCIGGMIWTGYDYPGESMGYPAKGWGGALIRTNNECRSGFYLIQSYWREEPM
VHFSVMDYFLADEGIKEHWDMPAYADHWQFSRFHKCLIPYSIVSNCEEVALYLNGKRF

Enzyme Prediction     

No EC number prediction in MGYG000000202_01828.

CDD Domains     

MGYG000000202_01828 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOV19967.1	2.16e-115	1	238	375	612
AFC30220.1	1.58e-111	1	237	376	612
AEI41711.1	1.58e-111	1	237	376	612
AFH62494.1	1.58e-111	1	237	376	612
QKS44534.1	4.76e-110	1	238	375	612

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6B6L_A	7.66e-14	72	236	452	621	Thecrystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838],6B6L_B The crystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838]
7RSK_A	1.40e-13	72	236	452	621	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7RSK_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
7CWD_A	4.22e-11	65	236	454	631	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
5T98_A	4.60e-10	66	236	460	645	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
4YPJ_A	8.31e-10	65	236	460	637	ChainA, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000081	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000202_01828.