CAZyme Information: MGYG000000202_01898

Basic Information

• Species: AF33-28 sp003477885
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; AF33-28; AF33-28 sp003477885
• CAZyme ID: MGYG000000202_01898
• CAZy Family: PL26
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
898	MGYG000000202_5|CGC6	102276.06	5.7139

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000202	5162288	Isolate	China	Asia

• Gene Location: Start: 291763; End: 294459 Strand: +

Full Sequence      

MKLHLLENCMAGGYAQFGSIWKKGAVHDCRFRLINEKKEDVFVQSRITAYWPDGSIKWAA
HTADSRAVGECAEIIPGGGGAPESRAKCTETKGGWRFCSPTLSLEIPKSGDVIFRDLKVN
GRLRMKNAYLKLLLERHFHVAGLDTQIQYSGRGVLKSAVMEESGPLMWSFRLEGIHELTE
IGEQKIPFILRLKLYHDTDRIDIQHTFLFDGDERTDFLKGIGIAATCPLSGETFDRHIRF
GTDYGSFHEAASLMLVWDHKRPGPIYERQIRGLPLEKPCIQPCIQSCMQSYMQPYIQPYI
SSAEEFERLKDIAQNCPVWDHYELAQDSDMHFGIRKRTAGTDRCFLDALHGKRAPGVMAF
GGSNGSILMGLKDFWQKYPSGLELQGLAADAAEAVIWIYSPSARAYDYRHYDHRAYAETC
YEGFPEVGATPYGVANTNDCSIAFQDEIIPSEDDLNRFAHSVNDPPVYFGEPAYYHDLRA
FGYWSLPSRQTQALAWIEEELDRAVDFYLKEVEARHWYGMYDYGDVMHTYDRFRHIWRYD
IGGYAWQNTELMPTMWLWLAFLRSGRGEILKLAEAMTRHASDVDVYHLGKLKGLGTRHGV
RHWGCSCKEIRIGMAGHYRFHYYLLCDRRFEDVFEDTKDADYSLLSMDPLRYVYGSGQSQ
LPTHARSGPDWAAMVSNWMTQWERGQDEQYLQKILTGMEDIKAAPLGLMSGPDFEYDPAT
GHLRYIGESATGGIHLQISLGGPQVWMELADLLGDEKWSELIAQYGRFYYLSPEEKREES
RGLVGERVFLYPVMAAAMAAYGAAKLGDHGLALRTVQYLFRALLPDDCDTGFAVSTLADC
GNRSVLSEIPWITTNFTSQWCLNAIMVLEFIRDAIPETLEEVRGLLADFPKEELFRTC

Enzyme Prediction     

No EC number prediction in MGYG000000202_01898.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL26	15	874	2.4e-275	0.9802784222737819

CDD Domains     

MGYG000000202_01898 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ94257.1	2.46e-305	20	892	1	849
AEC02734.1	2.43e-299	1	890	3	904
AOZ96961.1	5.44e-288	1	880	1	861
ABX43437.1	4.19e-287	1	878	5	876
QAV09731.1	4.59e-237	17	880	19	851

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XQG_A	2.39e-126	17	877	25	903	Crystalstructure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_B Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_C Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_D Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_E Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_F Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_G Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_H Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQJ_A Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_B Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_C Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_D Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_E Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_F Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_G Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_H Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum]
5XQ3_B	4.88e-125	17	877	25	903	Crystalstructure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum [Penicillium chrysogenum]
5XQ3_A	5.12e-125	17	877	25	903	Crystalstructure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum [Penicillium chrysogenum]
5XQO_A	1.86e-124	17	877	25	903	Crystalstructure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with tetrameric substrate [Penicillium chrysogenum],5XQO_B Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with tetrameric substrate [Penicillium chrysogenum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31530	3.44e-229	17	880	19	851	Uncharacterized protein YetA OS=Bacillus subtilis (strain 168) OX=224308 GN=yetA PE=4 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000202_01898.