CAZyme Information: MGYG000000202_02591

Basic Information

• Species: AF33-28 sp003477885
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; AF33-28; AF33-28 sp003477885
• CAZyme ID: MGYG000000202_02591
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
876	MGYG000000202_8|CGC2	99477.34	4.7138

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000202	5162288	Isolate	China	Asia

• Gene Location: Start: 222201; End: 224831 Strand: +

Full Sequence      

MEISRLRTNHVTEPMGYRLEKPVFSWIVSGAAGTRQEAARVKISRCEDMTDVVYDSGKRK
DISSLGFEADFIPEAVSRYYWEVTVWTDAEEEGSAVSWFETGKMKEPWQAQWIRAPFDKE
VHPIFIKEFELDGNIASARAYITGLGLYELKINGVRVGDEYLTPYYNDYNLWIQYQTYDI
TSLLTPGSNRVCVMLGNGWYKGRFGFVENMAELYGDEMKMLCEIDVKAADGKRTVIGSGP
DWDCIPSWIVSSSIYDGEVQDARMRVKNWSKDSLKAAGLCPALPADAPKAPVTERLSLPV
KIRQRWKKAELLCTPAGETVIDFGQVMTGWVEFDCDLPAGSRVFLQFGELLQNGNFYNEN
LRTAKEEFTYISDGQKAHVRPHFTFYGFRYMKVEGIDSVRPEDFTACVMYSDLEKVGSLT
TSNSKVNRLIENALWSQRGNFVDVPTDCPQRDERMGWTGDAEVFAATASLQMYTPAFYRK
FLYDMQLEQQTLGGSVPHVVPDILDQIASILHQEGDLAAGSCAWGDAATVIPWVSYLYYG
DRSLLESQFNNMKMWTDFIKREDDTRCGGRRLWQCGFHFADWLALDNPVAGSSFGGTEDY
YVASAYYYYSASLTAKAAKALGKEEEYQYYHNLAEEVKAAIQKEYFTVTGRIAIPTQTAM
AIALYMDLVPEQHRERIVRDLKKRLDDKNIHLDTGFVGTYQLCSALSLNGMADYAYTLLL
NEDFPSWLYEVNMGATTIWERWNSVLPDGLVSDTGMNSMNHYAYGSVVEWMYRYMCGINP
SEDAPGFKKARIEPQTDARFDYAKASYLSASGLYRSEWKRDGNRTVYTVEVPFDAQALFV
LARPAGNVLVNGEESEELRKNQRLLLMPGVYEITAE

Enzyme Prediction     

No EC number prediction in MGYG000000202_02591.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	314	838	9.8e-163	0.9861111111111112
CBM67	110	273	9.3e-29	0.8806818181818182

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.08e-120	414	775	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	5.34e-56	135	304	3	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	5.16e-31	313	410	2	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	8.64e-13	777	856	1	78	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHQ62976.1	0.0	1	876	1	876
QOV18450.1	0.0	1	873	1	872
AVM69218.1	0.0	1	873	1	922
QIZ07546.1	0.0	1	871	1	879
AYQ75447.1	5.37e-318	6	857	1	834

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GSZ_A	2.54e-145	125	846	134	851	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
3W5M_A	2.04e-126	135	832	316	985	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6I60_A	1.59e-119	6	867	35	930	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KNB2	8.30e-139	14	876	47	923	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
Q82PP4	8.47e-126	135	832	316	985	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
P9WF03	4.91e-120	14	860	43	897	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	7.37e-84	1	869	30	935	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000026	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000202_02591.