CAZyme Information: MGYG000000202_02638

Basic Information

• Species: AF33-28 sp003477885
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; AF33-28; AF33-28 sp003477885
• CAZyme ID: MGYG000000202_02638
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367	MGYG000000202_9|CGC1	42916.89	5.1888

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000202	5162288	Isolate	China	Asia

• Gene Location: Start: 12450; End: 13553 Strand: -

Full Sequence      

MTQKQYFQIIEKVGENLNDFLYSSDERYRSHLTESLGWTPLQAKRFACWDWTHGVGLYGI
YKLYQFTKDERYLDYIEAWLKNRMEIGLPEKNVNTVAPLLVMACVHEIRPSKEYEAVMRE
WAEWIMHDMKRTAEEGLQHSHAELENDQELWDDTLLMTVLFLAKAGKVFDRQDYTDEAIY
QFMIHVKYLTDTKTGLWYHGWTFAERNNFANALWGRGNCWVTIFIPEFLEMFELPSYIRK
YAVYALQEQAKALARYQSPSGMWHTLIDDESSYLESSCTAGFCYGILKGIRKGYLDPGYE
ECGKKAIEAVLAKISPEGELMGVSYGTNVGRTLEHYRQIPMSKMHYGQALALLALIEGLE
WYREQEA

Enzyme Prediction     

No EC number prediction in MGYG000000202_02638.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	43	357	1.4e-104	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	3.17e-105	49	359	34	350	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	6.04e-95	49	357	27	338	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUI24631.1	1.31e-123	10	359	9	358
QEY12593.1	3.03e-122	1	362	8	367
AQY49984.1	3.03e-122	44	359	47	364
CBV42848.1	6.20e-122	1	362	19	378
CAC83616.1	1.76e-121	41	362	55	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3PMM_A	1.65e-108	41	362	58	381	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
3QWT_A	4.53e-108	9	362	29	380	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
4XUV_A	4.19e-104	41	357	39	367	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
1NC5_A	1.49e-24	49	357	39	363	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	6.34e-24	49	357	29	353	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	8.20e-57	49	360	29	337	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
O34559	8.14e-24	49	357	39	363	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P9WF04	5.80e-09	151	361	201	411	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000202_02638.