CAZyme Information: MGYG000000202_02785

Basic Information

• Species: AF33-28 sp003477885
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; AF33-28; AF33-28 sp003477885
• CAZyme ID: MGYG000000202_02785
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
704	MGYG000000202_9|CGC6	81049.07	5.3367

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000202	5162288	Isolate	China	Asia

• Gene Location: Start: 181854; End: 183968 Strand: -

Full Sequence      

MLSYYIDKSEIFGCTVHLTGWAVSDTGTLPEYRVTERHGEEMKFSFRRLDRPDASRSALG
DERQRDCGFDVKFDCNLEERYCLHISDGQKEKRLSILPKELIREQSRRYVNFKKMIRLTT
PAMAADDIRTLLKRGPVELKKQWRNRYETEENRYARWLEKHGECEPAALSWQPLISIVVP
VYKPPREFLKQMIASVRQQSYQNWQLCLADGEGSMEPVLRQAADEDSRIRYQILDENLGI
AGNSNAALELATGEYVGLLDHDDILEKHALYEVVKALNEDPDTDMLYSDEDKVSMDLRVY
FDAHLKPDFNLDLLRSNNYICHFFVARKELLDELGGFLPDYDGAQDYDLILRCSERARKI
CHIPRILYHWRTHQFSTSENPESKMYCYTSGKLALEAHLKRMGLNADVSLIGDHLGYYRV
KYRVTGKPKISILIPNKDQPDTLKACVDSIREKSTYGNYEIIIIENNSTGTEIFSLYEEL
KLDPRIRVAVWERDFNYPAINNFGASLAQGEFLLLLNNDTRVITPDWMEELLGTCQRPDV
GIVGAKLYYPDDTIQHAGVVMKLAGVCGHVFCGMDRSEPGRFARAVVQQDYSAVTAACMM
VKKSVYESAGGMDEAFAVAYNDVDFCLRVRGMGLLVVFTPFAELYHDESKTRGYEDNPEK
QKRFTEEKKRLLGRYQEYLEKGDPCYNPNLTLTAPDFSINMEDV

Enzyme Prediction     

No EC number prediction in MGYG000000202_02785.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	176	283	1e-22	0.6411764705882353
GT2	431	558	1.9e-18	0.7411764705882353

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	2.60e-108	173	372	1	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	5.48e-43	432	648	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd06433	GT_2_WfgS_like	4.47e-31	176	378	1	201	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	7.69e-26	428	688	3	257	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	3.92e-21	176	331	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM06872.1	1.26e-237	2	692	116	819
QBE99393.1	1.75e-225	114	699	10	604
QIB58022.1	2.48e-225	114	699	10	604
QMW77454.1	2.48e-225	114	699	10	604
QJU15221.1	3.03e-223	102	699	6	612

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	1.05e-07	174	277	6	109	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	8.90e-143	173	700	366	898	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	1.02e-114	167	696	313	837	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q7BLV3	2.57e-13	165	378	432	644	Hyaluronan synthase OS=Pasteurella multocida OX=747 GN=hyaD PE=1 SV=2
Q9CMP0	4.44e-13	173	378	433	637	Chondroitin synthase OS=Pasteurella multocida (strain Pm70) OX=272843 GN=fcbD PE=3 SV=1
Q58457	4.58e-12	172	388	7	231	Uncharacterized glycosyltransferase MJ1057 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1057 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000037	0.000003	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000202_02785.