CAZyme Information: MGYG000000202_02901

Basic Information

• Species: AF33-28 sp003477885
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; AF33-28; AF33-28 sp003477885
• CAZyme ID: MGYG000000202_02901
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
810	MGYG000000202_10|CGC2	93827.69	4.7879

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000202	5162288	Isolate	China	Asia

• Gene Location: Start: 78843; End: 81275 Strand: +

Full Sequence      

MERLSLNGVWQMQQDGWEEWIPASVPGSVYNDLLKAERMEDPYWRANETKALALMEYDYH
YRRSFRVEKELLAHDEVMLFCAGLDTLAEIRINGQVIGTADNMHREWEYPVKSYLAEGEN
EIQITFSSPTGYIREHYEENPNDGSDYAMKGFPNLRKAHCMFGWDWGPRLPDAGIWREIE
LRGEDTAVFESVSVRQKHEDGKVWLTAEAFCKYITGEPDEILFSVYTPEGELLKTVTAEE
KILVEQPKLWWPNGYGAQPLYRVSVTAYKDGQELDRWEKRIGLRTIGLKREKDEWGESFA
HVVNGVAIFAMGADYIPEDNILPRVNGARTRRLLEDCIAAHFNTVRVWGGGYYPEDVFFD
LCDELGLLVWQDMMFACAVYALTEKFEASVTEELICNIRRLRHHPSLALWCGNNEMEMFV
HADVWIKHPRQKADYIKMYEYVFPKLFAEHDPDGIYWPASPSSGGSFDDPNDYNRGDTHY
WEVWHGCKPFTDYRKYFFRYASEFGFQSFPSLKTVESFTLPADRNIFSYVMEKHQRNELA
NGKIMEYISQTFLYPGTFELLLYASQLLQAEAIRYGVEHWRRNRGRCMGAIYWQLNDCWP
VASWASIDYYGRWKALHYAARRFFAPVLLSCEEEGLLSQTIDVNAQAFEVKKRARFSVSN
ETMQTFDGTVEWSLRNPASEVLQNGQIEVHTGALSAEWVGDFDFNEAKVYENYISYRLLG
ENGAEISCDSVLFCPPKHFAFVDPQLQVESNGREITVTARAYARGVEIEFPDSDVVLSDN
YFNMDAGTKTVRVLRGEVKTVTVRSVYDIK

Enzyme Prediction     

No EC number prediction in MGYG000000202_02901.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	2	667	2.6e-101	0.6595744680851063

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.04e-107	1	782	10	773	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17753	Ig_mannosidase	1.41e-14	743	808	1	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
pfam17786	Mannosidase_ig	1.28e-12	658	738	7	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
pfam00703	Glyco_hydro_2	2.74e-09	220	284	37	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK10150	PRK10150	9.08e-09	2	415	11	417	beta-D-glucuronidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF25065.1	0.0	1	810	1	810
QTE69834.1	0.0	1	810	1	811
QTE73768.1	0.0	1	810	1	811
AHF25196.1	0.0	1	810	1	823
AUS95659.1	0.0	1	810	1	803

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BYE_A	1.09e-158	1	793	3	832	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	1.12e-158	1	793	3	832	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
2VJX_A	1.42e-158	2	808	7	836	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	1.50e-158	2	808	9	838	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	1.55e-158	2	808	9	838	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1CGA8	1.23e-112	1	671	4	697	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
Q4WAH4	1.23e-112	18	671	24	697	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
B0YBU9	4.70e-112	18	671	24	697	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1
Q5B7W2	6.27e-112	10	634	13	663	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
A1D911	6.57e-112	18	671	24	697	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000202_02901.