CAZyme Information: MGYG000000202_03082

Basic Information

• Species: AF33-28 sp003477885
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; AF33-28; AF33-28 sp003477885
• CAZyme ID: MGYG000000202_03082
• CAZy Family: PL22
• CAZyme Description: Oligogalacturonate lyase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
384	MGYG000000202_11|CGC1	43888.13	5.1337

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000202	5162288	Isolate	China	Asia

• Gene Location: Start: 63772; End: 64926 Strand: +

Full Sequence      

MSMIGREYPSEIVKYQDPKTGKEITQLTTGHQNVHMYFTDNSFTTGDREIYFTSTRPYED
QERSNLFKMDLETGIMTQLTDEVNGIGSCTKTPDSEIAVYVLNRCQVVKLNTRTGQKDII
YEEMGDYQIGHPFISHDKKYIGFERNEKQEHGVGKNYTGFAETMFGIKKSYIMIVDIDGR
EAKNVYSDTHWIGHFQFSPDDSNIAMFCHEGPWNLVQQRIWILDIAAGDAIPCYRQQQDD
SIGHEFWTRDGLIFFDDRMAGHDGTITVSKTQAVATQDQIKPGQIPFVGLADRTGRLLRR
IDMPFYCNHYHANNDNSVLVGDAVEDLVLIDLKGEKPELTTLCYHGTSWNGGYTHCHPTY
SWGADQILYTSDKDGLCNLYIVRP

Enzyme Prediction     

No EC number prediction in MGYG000000202_03082.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL22	27	156	5.3e-20	0.4867924528301887
PL22	171	260	3.9e-18	0.4517766497461929

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14583	Pectate_lyase22	1.39e-30	5	381	4	379	Oligogalacturonate lyase. This is a family of oligogalacturonate lyases, referred to more generally as pectate lyase family 22. These proteins fold into 7-bladed beta-propellers.
COG0823	TolB	1.15e-04	15	144	222	343	Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking, secretion, and vesicular transport].
COG0823	TolB	0.002	168	258	216	302	Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking, secretion, and vesicular transport].
COG0823	TolB	0.003	20	146	270	389	Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking, secretion, and vesicular transport].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJQ29048.1	3.46e-155	3	383	1	381
SET71872.1	1.73e-143	3	383	1	381
AGK03506.1	3.26e-142	14	383	8	382
AWR87801.1	3.16e-141	14	383	3	377
ABU58528.1	2.64e-133	6	383	3	390

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3PE7_A	2.73e-30	5	381	4	379	Oligogalacturonatelyase in complex with manganese [Yersinia enterocolitica subsp. enterocolitica 8081]
3C5M_A	3.13e-26	15	381	14	379	Crystalstructure of oligogalacturonate lyase (VPA0088) from Vibrio parahaemolyticus. Northeast Structural Genomics Consortium Target VpR199 [Vibrio parahaemolyticus RIMD 2210633],3C5M_B Crystal structure of oligogalacturonate lyase (VPA0088) from Vibrio parahaemolyticus. Northeast Structural Genomics Consortium Target VpR199 [Vibrio parahaemolyticus RIMD 2210633],3C5M_C Crystal structure of oligogalacturonate lyase (VPA0088) from Vibrio parahaemolyticus. Northeast Structural Genomics Consortium Target VpR199 [Vibrio parahaemolyticus RIMD 2210633]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59418	1.95e-28	5	383	4	381	Oligogalacturonide lyase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) OX=218491 GN=ogl PE=4 SV=2
P21258	1.32e-27	5	383	4	381	Oligogalacturonate lyase OS=Dickeya dadantii (strain 3937) OX=198628 GN=ogl PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000034	0.000009	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000202_03082.