CAZyme Information: MGYG000000202_03509

Basic Information

• Species: AF33-28 sp003477885
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; AF33-28; AF33-28 sp003477885
• CAZyme ID: MGYG000000202_03509
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1097		123936.63	5.1095

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000202	5162288	Isolate	China	Asia

• Gene Location: Start: 114061; End: 117354 Strand: -

Full Sequence      

MKYSFHYCWHFKLADCFPVRKAMDSFRDQNGRYFYEPEYQENDWQEVSLPHTFNDADLFR
DRIEDAGSGQKRTVSFYRKWFTLKPEEKGKKVLIEFEGIRQTCYLYINGHMAGYLESGVA
PFGFDLTNWINYENPNLIAVVTDNTSTRNLDVCTAETPNAPDVEPGSYLFPITEAADVPA
DRVGVNYFWNCNDFNPSIGGLSKNVWLHVVNRLYLTLPLYSNLRTKGLYVYGSRYDIPEK
SAQIHAVAEVRNETGTDKSVRLDIRIRDAEGNVAAAFSSETVCVPSVTLPAPELSIIPKD
AYRKEGTHYVPVDDEDAVKETETDSLMVSVVKACAGAADLRFWAIDDPYLYSVEADLVCD
EEVVDSQTIITGFRKVTYDCSKGLMINDMPVWLTGYAQRSANEWAAVGAAVDWLKDYDAK
LIRESNANHIRWMHVAACPADIRACDRRGIVCTQPAGDKERENFGRQWDQRVELMRDVIV
YFRNNPSIVFWEVGNNAVNKKHMREMRLLKGVLDPNGGRMIGCRTINTKEVVEEAEYTGT
MLNRHAGSFQAKLMPITETEYLREEAPRRVWDDFTPPDYDYDNLWLGKAGKKQPGGDYHD
LTSEDLVLRAASGYSEFFNDRIGGASGKDLYSATAALCWTDSAQHGRQAFSENARMSGRV
DAVRVKKQVFDVFRVMQSDEPQLKIVGHWNYPQEDGISYRYAEKEFDGHYWVKNGKYAYR
NPKDKTVYVIGSYSIKKMELFINGVLAGSCDKPNSTFVFAFPHIDITQSGRIEAVGYGYD
GKEAVRDLIETVGEPAQLKLTLHTGRNGLMADGADVAYADVEVLDEEGRLCPLCYDRIDF
DLDGPAQFLGGYNSGKFAGYGRDNSVIHKNHVYAECGNNRVFIRSAMSAGKICLKAVMKP
SEVSDGTMHAAKELRAEVSLESVPVKLSALKESAAVLEQLPRLEYAAQKPEGKPAFLPIP
EADKQKYVPELHEYCKILINGDEPDTHSIRSVYEDYGVWGPVLYILERLVQRDPDRLSYT
YDPDVKRLVVKSGGHEILAETGRTHLLVDGEENLMNGEPRIQEGTFYMEISALIPWIKGL
TAAYDDGIRAYRIKTDN

Enzyme Prediction     

No EC number prediction in MGYG000000202_03509.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	9	515	1.3e-61	0.46143617021276595

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	2.85e-16	23	522	9	432	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam18565	Glyco_hydro2_C5	1.81e-14	800	896	1	92	Glycoside hydrolase family 2 C-terminal domain 5. Domain 5 is found in dimeric beta-D-galactosidase from Paracoccus sp. 32d, which contributes to stabilization of the functional dimer. It is suggested that the location of this domain 5, may be one of the factors responsible for the creation of a functional dimer and cold-adaptation of this enzyme.
PRK10150	PRK10150	1.50e-09	9	495	19	416	beta-D-glucuronidase; Provisional
pfam02837	Glyco_hydro_2_N	1.14e-07	26	146	1	137	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
pfam02836	Glyco_hydro_2_C	5.88e-06	384	515	8	154	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASA20342.1	0.0	3	1094	11	1087
QGH35456.1	0.0	3	1094	19	1096
AGT88372.1	2.01e-195	39	896	24	777
ADJ49535.1	2.01e-195	39	896	24	777
QMV17606.1	2.10e-164	44	899	76	846

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HPD_A	1.13e-139	25	896	45	790	Thestructure of a beta-glucuronidase from glycoside hydrolase family 2 [Formosa agariphila KMM 3901]
7CWD_A	8.49e-38	36	896	25	787	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
4YPJ_A	3.02e-35	27	896	20	793	ChainA, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
3GM8_A	2.39e-32	39	850	29	743	ChainA, Glycoside hydrolase family 2, candidate beta-glycosidase [Phocaeicola vulgatus ATCC 8482]
6B6L_A	8.82e-32	41	908	31	775	Thecrystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838],6B6L_B The crystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KN75	5.00e-139	25	896	36	781	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
A7LXS9	1.57e-40	4	917	46	849	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
P77989	7.50e-38	28	896	18	723	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KM09	3.66e-21	4	853	50	767	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
Q56307	2.46e-11	34	497	61	442	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000079	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000202_03509.