CAZyme Information: MGYG000000202_03849

Basic Information

• Species: AF33-28 sp003477885
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; AF33-28; AF33-28 sp003477885
• CAZyme ID: MGYG000000202_03849
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
637	MGYG000000202_17|CGC2	73564.08	4.7156

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000202	5162288	Isolate	China	Asia

• Gene Location: Start: 94034; End: 95947 Strand: +

Full Sequence      

MKAYQNYLVESLGIGCLKPRGWLARELKLQMEGITGELDENWGSINRFSDWLGGTNIGWE
RPPYWLDGLVPLAWLLGDEKRIEKARSWMEWTLNSQRENGDFGPHYWTQEFDDTLFWPKF
VMLKALVSYYEAENNPKVLEFMSRYYRFCDTLLDTYHMSGWDEARAGDFAWSVCWLYEKT
HEEFLTGLLDKINSQSLNWTECLENCPFTHPTAYYYNWKELTDKSSRSGWYTIMKYHATH
IVNVTMGLKQPVMAYKAGGEKKYLDALYAGMKSYMKYHGQVTGVYSGDEHLSGPNPTQGT
ELCSVVEFLFSLNAIFQQTGDARFMDLLERIAYNALPGTITEDFTGHQYDQQANQVKVSM
ESRNWYNNGDRANLFGFEPNFGCCLANMHQGWPKLIRNAFFMNGQEELVFGAYMPVSALW
QREDGDIRITEETEYPFRDTVTIAFEMDEPREFTCRIRIPGWCSSARIEYNGEVIGSEAE
DGYVSLHRVFENGSRIVLHFPMEITLKTGWYHNGMSVERGPLVYALNIKERWEKLGQGHP
KFPDCEIYPESRWNYALDTSVPMEAVLSECLSEQPFSKENPPVRILAAGRPVESWQMENN
SAGDLPESPVALDAAPETVELVPYACTKLRISLFPWL

Enzyme Prediction     

No EC number prediction in MGYG000000202_03849.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	122	525	2e-34	0.7614503816793893

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	1.39e-38	64	525	62	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	8.44e-24	283	526	270	502	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJE95537.1	6.73e-119	11	635	42	646
QNF30112.1	1.09e-115	3	635	30	654
QDW25584.1	1.11e-115	5	635	36	648
QXU43103.1	2.04e-115	11	635	39	645
ACU60445.1	4.30e-115	11	635	42	649

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	2.12e-17	65	526	82	561	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	3.46e-16	294	526	326	561	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6EX6_A	7.98e-16	294	525	308	545	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
5MQO_A	4.63e-12	294	526	374	608	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
6YQH_AAA	8.73e-12	285	507	321	541	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999940	0.000077	0.000006	0.000000	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000202_03849.