CAZyme Information: MGYG000000202_04292

Basic Information

• Species: AF33-28 sp003477885
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; AF33-28; AF33-28 sp003477885
• CAZyme ID: MGYG000000202_04292
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
846	MGYG000000202_23|CGC2	91345.1	4.1984

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000202	5162288	Isolate	China	Asia

• Gene Location: Start: 39706; End: 42246 Strand: -

Full Sequence      

MSLQNEPSTATAYQSCWYDKVQYKRVAIMLRHTLDAAGYDGVKLMGPESDEYKNSVVWMG
EGFSELLNDPEYNDAIDVLASHSYKGKDATDQNIIDWAQNVAKFPEKEAWMTEYCTAGNQ
MGDLEIDRAIEAMRILTSDLAWGGINSWFWWLGWDPRYSAKNPYQEVILEGEGKTDLYKG
TTYQVLAQLFNSVPVNSHVQRMSTDDPTAANKAALLSDLVAFNTGSGTVCMITNTSRVAK
AYDISGLKGQSASVYTTSEVNQSVKNTDSINIIGETAKDVFVPARSIVIVTTDAADHAAP
AVSVDENPQLFEENGSYTSRDQILHLSGSVDEQASVTVNGREVALGADFTFTADITLTEG
GNIITIEAKDVNGNRSVKKLNVKYDPSYLALVMEKTADRVNNTGYTLKGRVNVPAEVTVN
GTVVEVKDDLTFEHQVTLNQGVNTFEVAAVSTEGTKTVTVKVSCDSVAPVITVNQQGGTV
TDSEYVITGSVSETLAGFRVDGEDVSVSLDDTFITKVSLKEGKNEIKLTGTDPYKNEGTT
VLTITYNRTETSPLLPDPDNAVAYAVRTDNKVTVDGDISEADWAISQKAAKPLSGTPNNI
FNFGTMWDDDYLYVAAVVQDEALCFGDEKNRQYMQDCFELFLNPTNSKAGAYSGKDMQLF
AGWDKDRQNAFDNGKGILTGWKDLEDGYSVEMAIPWASLDITDPAADLAIGFDVANDDSD
IYGSRQHIIGWAGTGDNWQDTSKFGTLILSVKKDQGTDNRPDLETDSDPGSSNSGSDSGS
SGSTGAKDPVSPAPSADTPNPPAPDNLAAASPNAGDHTPISIFAALLFLSGALAIALIRA
SKAKRI

Enzyme Prediction     

No EC number prediction in MGYG000000202_04292.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM9	596	749	7.7e-34	0.8571428571428571
GH30	1	287	4.4e-23	0.5635491606714629

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam06452	CBM9_1	1.44e-29	583	749	21	181	Carbohydrate family 9 binding domain-like. CBM9_1 is a C-terminal domain on bacterial xylanase proteins, and it is tandemly repeated in a number of family-members. The CBM9 module binds to amorphous and crystalline cellulose and a range of soluble di- and monosaccharides as well as to cello- and xylo- oligomers of different degrees of polymerization. Comparison of the glucose and cellobiose complexes during crystallisation reveals surprising differences in binding of these two substrates by CBM9-2. Cellobiose was found to bind in a distinct orientation from glucose, while still maintaining optimal stacking and electrostatic interactions with the reducing end sugar.
cd00005	CBM9_like_1	8.30e-29	564	749	1	184	DOMON-like type 9 carbohydrate binding module of xylanases. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. The CBM9 domain frequently occurs in tandem repeats; members found in this subfamily typically co-occur with glycosyl hydrolase family 10 domains and are annotated as endo-1,4-beta-xylanases. CBM9 from Thermotoga maritima xylanase 10A is reported to have specificity for polysaccharide reducing ends.
cd09619	CBM9_like_4	2.15e-23	571	745	1	187	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other domains.
cd00241	DOMON_like	3.55e-13	595	729	14	157	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.
cd09620	CBM9_like_3	2.79e-11	574	699	1	150	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily may co-occur with various other domains.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHW33438.1	1.24e-108	2	749	195	962
QHT59779.1	1.36e-103	2	750	195	967
ANE48490.1	2.11e-69	296	753	726	1185
QJC51548.1	1.56e-35	557	749	1449	1639
QHW32944.1	3.54e-33	572	751	540	718

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1I82_A	1.51e-19	574	749	12	187	Family9 Carbohydrate-Binding Module From Thermotoga Maritima Xylanase 10a With Cellobiose [Thermotoga maritima],1I8A_A Family 9 Carbohydrate-Binding Module From Thermotoga Maritima Xylanase 10a With Glucose [Thermotoga maritima],1I8U_A Family 9 Carbohydrate-Binding Module From Thermotoga Maritima Xylanase 10a [Thermotoga maritima]
7NWN_AAA	3.17e-11	574	754	32	207	ChainAAA, Beta-xylanase [Caldicellulosiruptor kristjanssonii I77R1B],7NWO_AAA Chain AAA, Beta-xylanase [Caldicellulosiruptor kristjanssonii I77R1B],7NWP_AAA Chain AAA, Beta-xylanase [Caldicellulosiruptor kristjanssonii I77R1B],7NWQ_AAA Chain AAA, Beta-xylanase [Caldicellulosiruptor kristjanssonii I77R1B]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P38535	5.02e-18	606	752	754	897	Exoglucanase XynX OS=Acetivibrio thermocellus OX=1515 GN=xynX PE=3 SV=1
P36917	5.19e-18	472	752	772	1045	Endo-1,4-beta-xylanase A OS=Thermoanaerobacterium saccharolyticum OX=28896 GN=xynA PE=1 SV=1
Q60037	1.32e-16	574	749	882	1057	Endo-1,4-beta-xylanase A OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=xynA PE=1 SV=1
Q60042	2.03e-15	574	749	878	1053	Endo-1,4-beta-xylanase A OS=Thermotoga neapolitana OX=2337 GN=xynA PE=1 SV=1
O69230	3.39e-10	606	752	942	1086	Endo-1,4-beta-xylanase C OS=Paenibacillus barcinonensis OX=198119 GN=xynC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
819	841