CAZyme Information: MGYG000000202_04295

Basic Information

• Species: AF33-28 sp003477885
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; AF33-28; AF33-28 sp003477885
• CAZyme ID: MGYG000000202_04295
• CAZy Family: GH42
• CAZyme Description: Beta-galactosidase BgaA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
680	MGYG000000202_24|CGC1	78139.85	5.6179

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000202	5162288	Isolate	China	Asia

• Gene Location: Start: 1394; End: 3436 Strand: +

Full Sequence      

MEHSIEMDRIKLGVCYYPEHWDASLWQDDLRRMKECGIEMIRVAEFAWSLMEREEGVYDF
SFWDRFLELAGQEEMQVIFCTPTATPPAWLTEKYPEVLNADGDGHLIRHGMRRHYNLTSI
KYRELCARLVEKMGEHFNRYPCIIGWQLDNEINCEISEYYAQSDHAAFRSYLKEKYKTLD
ELNDKLGTVFWNQTYTDWNHIFLPRRSPQGLDIANPHLKLEQKRFISRSAVSFLAEQAAI
LKVTAGGRFITTNGIFQDIDYQELLDAGVDFICYDNYPNFAYDLSHKPGEGNGMKDRNSS
FNLARVRSISPVFGIMEQQSGPGGWNFRMMQPAPKPGQMRLWTWQAIAHGADMVSYFRWR
TCSVGTEIYWHGLNDYSNQPNRRLEELKRIHEELAKADGIAGHPCRARVAILTDWDNTWD
GEFDLWHGPLRQASMDGWFCALQRNHIPFDFVDFRDTADAADLAGYELIVYPHATLLNQK
RADILKAYAEQGGQLILGCRSGYKDMYGRCPMQAMPGPAADLCGVRVKDYTLLGPMDEEE
YLIWDGEQVSAPVFNDILEPLPGAKTAGVFRNNYYDGQPALVYKKHGRGSVWYFGAGFAC
DTAELFLKKLGIQSPVYGRLLLPASVELTVRGSRMFLLNYDKEPCDITLKEPLPELLSGR
KLSGKCAMEPYGVWILPFHE

Enzyme Prediction     

No EC number prediction in MGYG000000202_04295.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH42	15	395	3.3e-123	0.9946091644204852

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02449	Glyco_hydro_42	2.80e-133	15	396	1	375	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
COG1874	GanA	7.37e-103	12	676	18	670	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
pfam08532	Glyco_hydro_42M	8.50e-39	407	627	1	207	Beta-galactosidase trimerisation domain. This is non catalytic domain B of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. This domain is related to glutamine amidotransferase enzymes, but the catalytic residues are replaced by non functional amino acids. This domain is involved in trimerisation.
cd03143	A4_beta-galactosidase_middle_domain	4.29e-16	409	534	1	124	A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. This group includes proteins similar to beta-galactosidase from Thermus thermophilus. Beta-Galactosidase hydrolyzes the beta-1,4-D-galactosidic linkage of lactose, as well as those of related chromogens, o-nitrophenyl-beta-D-galactopyranoside (ONP-Gal) and 5-bromo-4-chloro-3-indolyl-beta-D-galactoside (X-gal). This A4 beta-galactosidase middle domain lacks the catalytic triad of typical GATase1 domains. The reactive Cys residue found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow in typical GATase1 domains is not conserved in this group.
pfam01301	Glyco_hydro_35	5.64e-05	24	94	24	104	Glycosyl hydrolases family 35.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNO17813.1	1.32e-287	4	676	22	698
AEF83220.1	3.96e-257	1	672	1	676
QSF47282.1	3.33e-256	1	676	1	683
AIQ18153.1	3.57e-253	1	676	1	683
AIQ22146.1	1.97e-252	1	676	1	682

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6LVW_A	3.63e-107	10	658	1	653	PolyextremophilicBeta-galactosidase from the Antarctic haloarchaeon Halorubrum lacusprofundi [Halorubrum lacusprofundi ATCC 49239]
1KWG_A	8.17e-99	12	662	2	634	Crystalstructure of Thermus thermophilus A4 beta-galactosidase [Thermus thermophilus],1KWK_A Crystal structure of Thermus thermophilus A4 beta-galactosidase in complex with galactose [Thermus thermophilus]
6Y2K_A	5.42e-89	10	640	1	624	ChainA, beta-galactosidase [Marinomonas sp. ef1]
3TTS_A	6.97e-78	9	676	8	672	ChainA, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_B Chain B, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_C Chain C, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_D Chain D, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_E Chain E, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_F Chain F, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_A Chain A, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_B Chain B, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_C Chain C, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_D Chain D, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_E Chain E, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_F Chain F, Beta-galactosidase [Niallia circulans subsp. alkalophilus]
4UCF_A	6.73e-77	9	676	19	687	Crystalstructure of Bifidobacterium bifidum beta-galactosidase in complex with alpha-galactose [Bifidobacterium bifidum S17],4UCF_B Crystal structure of Bifidobacterium bifidum beta-galactosidase in complex with alpha-galactose [Bifidobacterium bifidum S17],4UCF_C Crystal structure of Bifidobacterium bifidum beta-galactosidase in complex with alpha-galactose [Bifidobacterium bifidum S17],4UZS_A Crystal structure of Bifidobacterium bifidum beta-galactosidase [Bifidobacterium bifidum S17],4UZS_B Crystal structure of Bifidobacterium bifidum beta-galactosidase [Bifidobacterium bifidum S17],4UZS_C Crystal structure of Bifidobacterium bifidum beta-galactosidase [Bifidobacterium bifidum S17]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B9LW38	1.99e-106	10	658	1	653	Beta-galactosidase Bga OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) OX=416348 GN=Hlac_2868 PE=1 SV=1
D9SM34	1.20e-103	10	680	1	659	Beta-galactosidase BgaA OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=bgaA PE=1 SV=1
O54315	5.18e-101	12	662	2	634	Beta-galactosidase BgaA OS=Thermus sp. OX=275 GN=bgaA PE=1 SV=1
P94804	1.15e-100	12	657	3	638	Beta-galactosidase BgaH OS=Haloferax lucentense (strain DSM 14919 / JCM 9276 / NCIMB 13854 / Aa 2.2) OX=1230452 GN=bgaH PE=1 SV=2
Q8GEA9	1.52e-99	12	662	2	634	Beta-galactosidase BgaA OS=Thermus sp. OX=275 GN=bgaA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000074	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000202_04295.