CAZyme Information: MGYG000000203_00518

Basic Information

• Species: Butyricimonas virosa
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Butyricimonas; Butyricimonas virosa
• CAZyme ID: MGYG000000203_00518
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
472	MGYG000000203_2|CGC4	55022.55	6.6211

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000203	4537346	Isolate	China	Asia

• Gene Location: Start: 239322; End: 240740 Strand: +

Full Sequence      

MSIISCIISRLKRDEQTDTYVHFEQTATLREIVTTIDSPYVFFYTKYPTPRLGEHAQKRF
LQVAQATGAVMLYSDYYTEQNGSQTAHPTIDYQLGSVRDDFDFGSILLFRTDVLKKVISE
MDTEYNFAALYDLRLRLSREGLIFRIPEFLYSEKEHDSRRSGEKQFDYVNPRNREVQIEM
EQAFTAHLKAIGAYLPPVFKTIPFQDEYFETEVSVIIPVRNREKTIAEAIRSVFSQQTNF
KYNILVIDNHSTDDTTAIVKKMAQKHSQIIHIIPPRTDLGIGGCWTHAIMSEHCGRFAIQ
LDSDDLYINRHVLQRIVDTFHKHQCAMIIGSYKMVNFKLEEIPPGIIDHKEWTPDNGRNN
ALRINGLGAPRAFYTPLLRQIRIPNVSYGEDYATALAISREYQIERIYEPLYLCRRWEGN
SDADLNIQRVNANNYYKDKIRMIEILARQWEIENGELKIENEEKSKILNLKS

Enzyme Prediction     

No EC number prediction in MGYG000000203_00518.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	214	351	4.9e-19	0.7823529411764706

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00761	Glyco_tranf_GTA_type	4.07e-18	215	366	1	150	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
pfam00535	Glycos_transf_2	1.21e-17	214	373	1	156	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG0463	WcaA	9.04e-15	212	307	4	96	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd04179	DPM_DPG-synthase_like	1.29e-13	215	334	1	118	DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.
cd02525	Succinoglycan_BP_ExoA	7.87e-13	213	330	2	116	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO51331.1	0.0	1	465	1	465
AZS29649.1	1.04e-315	1	456	1	456
SNV44901.1	4.36e-193	16	448	21	453
ADY34260.1	4.36e-193	16	448	21	453
ASB50036.1	1.67e-190	23	448	54	479

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P71054	1.97e-09	212	335	6	126	Putative glycosyltransferase EpsE OS=Bacillus subtilis (strain 168) OX=224308 GN=epsE PE=2 SV=2
B5L3F2	3.12e-07	206	452	2	218	UDP-Glc:alpha-D-GlcNAc-diphosphoundecaprenol beta-1,3-glucosyltransferase WfgD OS=Escherichia coli OX=562 GN=wfgD PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000008	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000203_00518.