CAZyme Information: MGYG000000206_00128

Basic Information

• Species: Lachnoclostridium_B sp900066555
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnoclostridium_B; Lachnoclostridium_B sp900066555
• CAZyme ID: MGYG000000206_00128
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1137	MGYG000000206_1|CGC2	131669.02	7.0924

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000206	2952936	Isolate	China	Asia

• Gene Location: Start: 151486; End: 154899 Strand: +

Full Sequence      

MFDKIQRKSLGIKCAIDICQYENGVFCVKGWMFSGKQKMQRMQLVVEVGRVKYPVDISSH
LKRSDVYREFQMENAKKSGFYGEVRIENVESFSVNLVSEFNGQKNVWKLGKYKSDEKVDP
QKQPNIEGIDIGDKEIEVMGLIASDKLREVYYPNDYKSELIDVIVPVYNGYQYFDALFSS
IEKTEMKYRLIILNDCSPDERVLPYLKEYAGKHSEVILIENETNLGFVKNVNKALELAKG
HHVALVNSDVELPELWLERLMLPILESDDVASSTPYTNCGTLVSFPKMGEDNSLFKDFTL
AEIDEEFQKIVPRYASLPTGVGFCMGMSKNAIEKIGVLDADSFGMGYGEENDWCQRAILA
GYRNVQVENLFVYHKHGGSFLSEDKKRYLEEHAKILSKKHPTYNKQVAHFFAVDPNKDIR
KLVKYRLLKKSESEKVIVAFDHDIGGGATSYLNNKQREYLDKGYVFYVVRYNYVQDYYQI
FMHADKDKYEFYVKTQEELMKALQFFGAKELWINELVTYPTLYKLLERIEEYRAQNEVKL
IMLLHDYFAICPTINLVNSDKKYCAIPECTQACKHCFANVHPDYVRDYQSMEEWRNRWGH
FLKRCDAILVFSNDSDRLLKKAYGKLDNVKVMPHQIGFMPKLDKKYKTTDTFNIGLLGIL
NYHKGAEIVKELLKEIERRGMNARVVLIGYSAEPINSPLFSETGRYAPDSIPALTLKHDI
DMFLIPSIWPETFCYTAEEIMKMNMPIMCFNIGAPVERVVNYEKGMIVDEMSGVAVVDAI
EASEVMARSKQMERKEKSVLFIAGEESFASRYRVSHLREQLLMQGISSKCIMLDKFKRCM
FKPYQSVVLYRVADQKVVNKIIKQAHRAGKEVYYDIDDYIFNYENIKHLSFLKGKEYKNF
EAYSKDIKEIMASCDGYIVSTNTLKDAILKDFPGKPVCINRNVSSLAMQICSLRRTLEKK
NDKVYLGYFSGTKTHNADFEKIKQPLLNLMQKNENVCLLVGGQITLPEEFNVYKDRIERF
KLIIWKKLPALIAKADINLMPLEDTFFHACKSENKWMEAALVHVPTVASWNQELQRAIEN
GVDGYLCKSEAEWEETLEQLVESEMLRKQIADAAFRKVMDKYTTFHVEKDVVDMLTK

Enzyme Prediction     

No EC number prediction in MGYG000000206_00128.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	162	335	2e-21	0.9882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	3.42e-28	163	376	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	2.38e-26	163	403	7	250	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	2.07e-19	162	332	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd03794	GT4_WbuB-like	4.36e-19	860	1124	114	383	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.
cd00761	Glyco_tranf_GTA_type	1.20e-17	163	279	1	117	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM10216.1	0.0	15	1135	742	1858
QCU01345.1	0.0	15	1135	755	1871
BBK78212.1	3.73e-209	16	780	9	782
QMW89726.1	3.73e-209	16	780	9	782
CBL21588.1	1.33e-159	15	644	755	1379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	1.07e-06	158	302	4	149	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32268	1.70e-06	160	277	7	124	Putative teichuronic acid biosynthesis glycosyltransferase TuaG OS=Bacillus subtilis (strain 168) OX=224308 GN=tuaG PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000206_00128.