CAZyme Information: MGYG000000208_00664

Basic Information

• Species: Eubacterium_G ventriosum
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eubacterium_G; Eubacterium_G ventriosum
• CAZyme ID: MGYG000000208_00664
• CAZy Family: GH55
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1365		150793.01	8.5867

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000208	2760783	Isolate	China	Asia

• Gene Location: Start: 265581; End: 269678 Strand: +

Full Sequence      

MKMKKMYKSLLSIVLAVAMLFTSQTFNMTVMAASAATSTDAIDGAEETTIHAEVFFVNVA
NGNIITVSGVKNDPILVDKKFTSINNVSDDGKFTTYYGTYKNNGIDDKANEVVNFATKSR
NTVWAANADDIIYQDARTVANDYAPTGWESVRIQHNDDGTVSFGSSADEKIFTLGKYKDE
EGTEHTKLAVSSKYHLGDKVGNEEKFIMYTGDEPKKARKVTLSDVSGDSVQVSWTTPKEH
IYSAFEVMYSTSENGNYRSAGLTIKNKMTVNNLLSEKQYFFKIRTITNTKEAGSYSAYAD
SEIAFTTTLSQTKPAKAEITDVTRNDKTGAQTIIWNKAANAKSYNIYRAEGRYAEYKLID
SIDGAKTSYTDTNPNTTSKYKNYYKVQAVNGNVNGEESEPYSLEISKFGKNVYVFNDADD
KDAISDKVNEIFGYQHYDQFGKNRYAFAFKPGDYTETVADAYDVGYYTQVIGLGKTPYDV
RLKNIKTPAALANGNVTCNFWVDVENFTIAQTTENPNYWEDSFKWAVSQAAPARRLNVER
QTLLQWTWGDNAWASGGYISDTKFHDSVGSWCQQQYYYRNCEFTTKQTENGSIYGINWNQ
IVQGCKNVDGTTLKDNSGNYFNAGGSLLQNNGISNWATNGCTTVLDKTDATREKPFLYFD
EDTDSYKVFVPAVRKDTTGVSWSENDMGKGKSLGLDSFYIVNPDVDTADTINAALGKGYN
LLLQPGIYKLDKAIEVTHENTIVLGLGMATFTSSDKNTDTFIRVAGKKWNSDYTKAEGNY
DIGGVEIAGVILDAGKHTNTLLEVGYEGANVDHSNNPCVLQDVICRVGGTGDLGTTGSCI
VVNSNNTIIDETWIWRADHGDNTGWYENTADHGLVVNGDNVTAYGLFIEHFQKYDVLWRG
EYGKTFFLQNEKCYDPQDQKEWMSHNNTVKGYSAYKVANDVKHHYAIGLGVYDVFINTNG
AEIFLDNAIEVPNADDVLIENACIVEIANGSGPKVGINRIINGTGCGITTGETSQTVSGK
KGGYAIQRLLYYRNKTSVSLPDSYDYSKDGGDGKDAYPTDPSTGLIVANKDENVKQPSDD
AIADKTIVKEQPTVDNSKTLGSDDTDDKYFDEKIKNCTDEWNKIQAASKTSYPETPKGDQ
TSLDDQVRTQYGVYVGMEYTVGDFIYRVTAIDSITSGRTKLIGVVAAKKSKLTKVTVPNT
ANFKGYGLNVTEVGDNAFKAMKKLKKVTFGANVKVIGKAAFSNCKKLNKINFKNVTTIGN
NAFAGCKALKKLTIGSKVTTIGKNAFKKCTKIKTVVIGKSVKTIKAKAFTKDNKIKKITF
KGKKLKTVKKNALSSKVKKNVKAKKTKLKGNKKAIKVFKKKLKIR

Enzyme Prediction     

No EC number prediction in MGYG000000208_00664.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH55	677	958	2.9e-54	0.422972972972973

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
sd00036	LRR_3	1.50e-30	1190	1320	14	136	leucine-rich repeats. A leucine-rich repeat (LRR) is a structural protein motif of 20-30 amino acids that is unusually rich in the hydrophobic amino acid leucine. The conserved eleven-residue sequence motif (LxxLxLxxN/CxL) within the LRRs corresponds to the beta-strand and adjacent loop regions, whereas the remaining parts of the repeats are variable. LRRs fold together to form a solenoid protein domain, termed leucine-rich repeat domain. Leucine-rich repeats are usually involved in protein-protein interactions.
sd00036	LRR_3	4.03e-30	1209	1320	1	113	leucine-rich repeats. A leucine-rich repeat (LRR) is a structural protein motif of 20-30 amino acids that is unusually rich in the hydrophobic amino acid leucine. The conserved eleven-residue sequence motif (LxxLxLxxN/CxL) within the LRRs corresponds to the beta-strand and adjacent loop regions, whereas the remaining parts of the repeats are variable. LRRs fold together to form a solenoid protein domain, termed leucine-rich repeat domain. Leucine-rich repeats are usually involved in protein-protein interactions.
pfam13306	LRR_5	1.23e-28	1180	1316	1	127	Leucine rich repeats (6 copies). This family includes a number of leucine rich repeats. This family contains a large number of BSPA-like surface antigens from Trichomonas vaginalis.
sd00036	LRR_3	1.84e-26	1190	1303	37	142	leucine-rich repeats. A leucine-rich repeat (LRR) is a structural protein motif of 20-30 amino acids that is unusually rich in the hydrophobic amino acid leucine. The conserved eleven-residue sequence motif (LxxLxLxxN/CxL) within the LRRs corresponds to the beta-strand and adjacent loop regions, whereas the remaining parts of the repeats are variable. LRRs fold together to form a solenoid protein domain, termed leucine-rich repeat domain. Leucine-rich repeats are usually involved in protein-protein interactions.
pfam13306	LRR_5	1.81e-20	1234	1320	1	86	Leucine rich repeats (6 copies). This family includes a number of leucine rich repeats. This family contains a large number of BSPA-like surface antigens from Trichomonas vaginalis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLY78983.1	5.14e-208	54	1038	181	1115
QLY78981.1	1.66e-201	54	1038	181	1121
BCL56920.1	3.03e-178	58	1111	196	1237
QMW75525.1	6.28e-173	58	1175	190	1281
QQV06003.1	6.28e-173	58	1175	190	1281

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4TZ1_A	1.02e-117	409	1018	9	547	Ensemblerefinement of the E502A variant of sacteLam55A from Streptomyces sp. SirexAA-E in complex with laminaritriose [Streptomyces sp. SirexAA-E],4TZ3_A Ensemble refinement of the E502A variant of sacteLam55A from Streptomyces sp. SirexAA-E in complex with laminaritetraose [Streptomyces sp. SirexAA-E],4TZ5_A Ensemble refinement of the E502A variant of sacteLam55A from Streptomyces sp. SirexAA-E in complex with laminarihexaose [Streptomyces sp. SirexAA-E],4TZ5_B Ensemble refinement of the E502A variant of sacteLam55A from Streptomyces sp. SirexAA-E in complex with laminarihexaose [Streptomyces sp. SirexAA-E]
4TYV_A	1.08e-117	409	1018	11	549	Ensemblerefinement of the E502A variant of sacteLam55A from Streptomyces sp. SirexAA-E in complex with glucose [Streptomyces sp. SirexAA-E],4TYV_B Ensemble refinement of the E502A variant of sacteLam55A from Streptomyces sp. SirexAA-E in complex with glucose [Streptomyces sp. SirexAA-E]
4PEX_A	1.47e-117	409	1018	21	559	Structureof the E502A variant of sacteLam55A from Streptomyces sp. SirexAA-E in complex with glucose [Streptomyces sp. SirexAA-E],4PEX_B Structure of the E502A variant of sacteLam55A from Streptomyces sp. SirexAA-E in complex with glucose [Streptomyces sp. SirexAA-E],4PEY_A Structure of the E502A variant of sacteLam55A from Streptomyces sp. SirexAA-E in complex with laminaritriose [Streptomyces sp. SirexAA-E],4PEZ_A Structure of the E502A variant of sacteLam55A from Streptomyces sp. SirexAA-E in complex with laminaritetraose [Streptomyces sp. SirexAA-E],4PF0_A Structure of the E502A variant of sacteLam55A from Streptomyces sp. SirexAA-E in complex with laminarihexaose [Streptomyces sp. SirexAA-E],4PF0_B Structure of the E502A variant of sacteLam55A from Streptomyces sp. SirexAA-E in complex with laminarihexaose [Streptomyces sp. SirexAA-E]
4PEW_A	2.04e-117	409	1018	21	559	Structureof sacteLam55A from Streptomyces sp. SirexAA-E [Streptomyces sp. SirexAA-E],4PEW_B Structure of sacteLam55A from Streptomyces sp. SirexAA-E [Streptomyces sp. SirexAA-E]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2NFJ9	4.18e-117	409	1018	65	603	Exo-beta-1,3-glucanase OS=Streptomyces sp. (strain SirexAA-E / ActE) OX=862751 GN=SACTE_4363 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000307	0.998819	0.000221	0.000245	0.000200	0.000174

TMHMM  Annotations     

start	end
13	35