CAZyme Information: MGYG000000209_02084

Basic Information

• Species: Eubacterium_F sp003491505
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eubacterium_F; Eubacterium_F sp003491505
• CAZyme ID: MGYG000000209_02084
• CAZy Family: GH10
• CAZyme Description: Endo-1,4-beta-xylanase Y

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
387	MGYG000000209_15|CGC2	44101.75	4.6939

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000209	3107681	Isolate	China	Asia

• Gene Location: Start: 80693; End: 81856 Strand: -

Full Sequence      

MKKAGRLAAAVFAAMLLVTGCGAPAEKKAVETTPEQSSKIEQKEEAKNLKDAFKKDFKVG
VAINPYQLKDEETKKIILENFNSITMENGMKPEAILDQRASENSKDGMPAINEENLEECL
SLAKDNGLVLRGHCLVWHNQTPEWFFCEKYDAGNAKVNRETMKKRMESYIKKVLSFCQEK
YPGVVYAWDVVNEACDDGGGYRTSSLWYEIYGDESYIEDAFTFARKYADKDVKLFYNDYN
EYMPSKVSTIAELVKKLYDKKLIDGVGFQSHWDMNYPDTGMISDAMQKYSEIGDLEIQFT
EVDMHNTDDSEEGLKKLADRYKEFFETIVKADREGKANVTSVTFWGLSDDVTWLTSFKGE
DSYPLLFDESHKKKACYDSVLAVGNEK

Enzyme Prediction     

EC	3.2.1.8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	49	381	3e-96	0.9867986798679867

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00331	Glyco_hydro_10	1.26e-109	49	382	1	310	Glycosyl hydrolase family 10.
smart00633	Glyco_10	2.17e-99	90	380	1	263	Glycosyl hydrolase family 10.
COG3693	XynA	1.83e-72	43	377	25	334	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAA43712.1	5.69e-96	48	381	2	335
ADL33823.1	4.83e-94	48	381	2	335
BCS82260.1	6.45e-84	49	384	70	417
AZT91389.1	3.61e-83	49	384	70	417
ADQ03735.1	1.24e-82	49	384	109	457

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2W5F_A	7.35e-71	49	383	184	527	ChainA, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],2W5F_B Chain B, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus]
6D5C_A	5.08e-70	48	381	22	348	Structureof Caldicellulosiruptor danielii GH10 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii],6D5C_B Structure of Caldicellulosiruptor danielii GH10 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii],6D5C_C Structure of Caldicellulosiruptor danielii GH10 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii]
2WYS_A	2.33e-68	49	383	184	527	ChainA, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],2WYS_B Chain B, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],2WZE_A Chain A, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],2WZE_B Chain B, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus]
5OFJ_A	3.22e-68	48	381	10	336	Crystalstructure of N-terminal domain of bifunctional CbXyn10C [Caldicellulosiruptor bescii DSM 6725]
7NL2_A	1.31e-67	48	381	11	338	ChainA, Beta-xylanase [Pseudothermotoga thermarum DSM 5069],7NL2_B Chain B, Beta-xylanase [Pseudothermotoga thermarum DSM 5069]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26223	1.14e-96	48	381	2	335	Endo-1,4-beta-xylanase B OS=Butyrivibrio fibrisolvens OX=831 GN=xynB PE=3 SV=1
P23557	3.29e-76	90	384	1	302	Putative endo-1,4-beta-xylanase OS=Caldicellulosiruptor saccharolyticus OX=44001 PE=3 SV=1
P29126	3.60e-68	48	383	629	952	Bifunctional endo-1,4-beta-xylanase XylA OS=Ruminococcus flavefaciens OX=1265 GN=xynA PE=3 SV=1
P51584	8.59e-68	49	383	195	538	Endo-1,4-beta-xylanase Y OS=Acetivibrio thermocellus OX=1515 GN=xynY PE=1 SV=1
P10474	2.37e-63	48	381	44	370	Endoglucanase/exoglucanase B OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=celB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000038	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000209_02084.