CAZyme Information: MGYG000000209_02389

Basic Information

• Species: Eubacterium_F sp003491505
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eubacterium_F; Eubacterium_F sp003491505
• CAZyme ID: MGYG000000209_02389
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
714		78125.07	9.6152

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000209	3107681	Isolate	China	Asia

• Gene Location: Start: 46861; End: 49005 Strand: -

Full Sequence      

MKKTFLCFSLSFALLASALNPLFSADVFAKAKLAKTKITLTVGQKKKITIKGKKKKAKYT
FKASNKKVSVNKKGVVTAKKAGKTKITVKEKLKKKTKKIGVVTIIIKSKVSNRKSIASAQ
PAATNSGNTGEKPTTAPTASATPTLPPTPTGSPKPTATPRPTENPDYSDLPSGFMKKNEA
NSGTLEEFYYDSTEVSEGETVKRHARVALPKGYTESKKYPVIYMQHGIFGNEYSLTGDNT
QYVAWNAMANDDMKDSIVVFANVCANKEGKGTGFSLEHYKAYDNFINDLTKCLMPAINKK
YSTLTGRENTAVCGFSMGGRVSLQIGFERPDLFGYIGAFCPAPGLLPYTMNGVTEPGFYT
DSTFTLPSEYLNDTYVQITKGFKDDVVKQHPLLYHQALQKTNTPHVYYETMGGDPSGSGS
GNHEKAVYQHGFYNFMKNIFKPNVTVPAGALRKDGVKGTTEEFEYESTAVAEGKTVTRKA
LVGLPDGYNPKKKYPVVYGLHGYGWGIYNLAQDGATDVVWNGYANDVMDEVIMVFPNICA
NESGQGNGYSQETYDAYDNCVNDIVNCLMPAINKHYSVKTGRLNTAVWGFSMGGREALNA
GFKHPDKFGYIGAFCPAPGVLPYSAEKGIFTEDTFTLPDAYKENTLVMIVKGKNDTTVGN
NPILYHKALEKNNVPHIYYETMGGDAVNRGGGGHQNVVYLHGLYNLMKRAFPCK

Enzyme Prediction     

EC	3.2.1.8	3.1.1.73

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	477	684	1.5e-32	0.8722466960352423
CE1	202	413	1.6e-32	0.8722466960352423

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00756	Esterase	6.97e-16	478	616	8	143	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG2382	Fes	6.33e-14	458	684	67	278	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
COG2382	Fes	2.28e-13	166	443	51	299	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
COG2819	YbbA	5.60e-13	202	342	22	171	Predicted hydrolase of the alpha/beta superfamily [General function prediction only].
pfam00756	Esterase	2.14e-11	202	341	7	143	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADL52399.1	1.89e-50	438	711	69	322
ADZ47894.1	6.19e-48	202	440	39	270
ADZ84563.1	2.32e-44	172	441	216	473
QEH70018.1	2.85e-43	172	441	216	473
CBL17231.1	1.95e-42	183	441	830	1073

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5CXU_A	2.26e-49	202	440	39	270	Structureof the CE1 ferulic acid esterase AmCE1/Fae1A, from the anaerobic fungi Anaeromyces mucronatus in the absence of substrate [Anaeromyces mucronatus],5CXX_A Structure of a CE1 ferulic acid esterase, AmCE1/Fae1A, from Anaeromyces mucronatus in complex with Ferulic acid [Anaeromyces mucronatus],5CXX_B Structure of a CE1 ferulic acid esterase, AmCE1/Fae1A, from Anaeromyces mucronatus in complex with Ferulic acid [Anaeromyces mucronatus],5CXX_C Structure of a CE1 ferulic acid esterase, AmCE1/Fae1A, from Anaeromyces mucronatus in complex with Ferulic acid [Anaeromyces mucronatus]
1JJF_A	4.79e-24	171	445	17	263	ChainA, Endo-1,4-beta-xylanase Z [Acetivibrio thermocellus]
1JT2_A	1.19e-23	171	445	17	263	ChainA, PROTEIN (ENDO-1,4-BETA-XYLANASE Z) [Acetivibrio thermocellus]
6RZN_A	1.07e-17	174	413	121	367	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
7B5V_A	2.57e-11	478	683	153	365	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10478	1.67e-21	171	445	36	282	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
D5EY13	2.59e-09	177	337	492	650	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
D5EXZ4	7.44e-09	438	630	418	603	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000943	0.998084	0.000391	0.000217	0.000177	0.000156

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000209_02389.