CAZyme Information: MGYG000000209_02408

Basic Information

• Species: Eubacterium_F sp003491505
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eubacterium_F; Eubacterium_F sp003491505
• CAZyme ID: MGYG000000209_02408
• CAZy Family: GH5
• CAZyme Description: Endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
323		36797.98	10.5734

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000209	3107681	Isolate	China	Asia

• Gene Location: Start: 13491; End: 14462 Strand: -

Full Sequence      

MKKRPLWLLTFGICFVFLFMSANTKAATPVQKWGQLKVSGTNIVNKDGKKVQLKGVSTHG
IAWFPQYVNKSCFQSFKKMGVNTIRLALYSDKGAGYSKSLYQKVDEGIRYATELGMYVVL
DWHILSDGNPKTSQKRAFQFFTRYAKKYGKQNNILYEICNEPNGNVTWAKDIKPYAKKAI
KKIRKYDKKNIIIVGTPTWSQDVDVVAKSPLKEKNIVYSLHFYAATHTDFLRNKCKSAYQ
SGLPMLVSEFSICDASGNGGIDKKSASKWMKLLKKYKIGHIAWNISNKNETSALIQSKCG
KTDKISYKNLSKSGKWIAKWWKK

Enzyme Prediction     

EC	3.2.1.4	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	47	281	7.8e-84	0.9873417721518988

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	8.46e-59	44	289	1	272	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	4.73e-09	34	225	45	272	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
COG3867	GanB	4.20e-05	60	168	55	187	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].
pfam07745	Glyco_hydro_53	1.96e-04	70	174	27	147	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM00780.1	2.25e-105	26	319	211	510
QWT53734.1	3.18e-105	23	319	208	510
AFA47670.1	1.69e-100	28	319	197	496
CBK83877.1	6.08e-100	21	317	219	523
SIP56455.1	1.75e-98	34	317	85	373

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3PZT_A	1.76e-93	21	317	24	320	Structureof the endo-1,4-beta-glucanase from Bacillus subtilis 168 with manganese(II) ion [Bacillus subtilis subsp. subtilis str. 168],3PZT_B Structure of the endo-1,4-beta-glucanase from Bacillus subtilis 168 with manganese(II) ion [Bacillus subtilis subsp. subtilis str. 168],3PZU_A P212121 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZU_B P212121 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_A C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_B C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_C C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_D C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168]
4XZW_A	9.05e-93	28	317	4	298	Endo-glucanasechimera C10 [uncultured bacterium]
4XZB_A	6.94e-90	28	317	4	299	endo-glucanaseGsCelA P1 [Geobacillus sp. 70PC53]
6GJF_A	1.39e-89	27	317	4	296	Ancestralendocellulase Cel5A [synthetic construct],6GJF_B Ancestral endocellulase Cel5A [synthetic construct],6GJF_C Ancestral endocellulase Cel5A [synthetic construct],6GJF_D Ancestral endocellulase Cel5A [synthetic construct],6GJF_E Ancestral endocellulase Cel5A [synthetic construct],6GJF_F Ancestral endocellulase Cel5A [synthetic construct]
5WH8_A	9.74e-73	28	319	6	305	CellulaseCel5C_n [uncultured organism]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10475	5.73e-91	8	317	16	325	Endoglucanase OS=Bacillus subtilis (strain 168) OX=224308 GN=eglS PE=1 SV=1
P23549	7.16e-89	8	317	16	325	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=1
P07983	3.17e-87	21	317	29	325	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=2
P15704	1.72e-83	3	319	12	333	Endoglucanase OS=Clostridium saccharobutylicum OX=169679 GN=eglA PE=3 SV=1
Q59394	3.79e-78	9	317	12	324	Endoglucanase N OS=Pectobacterium atrosepticum OX=29471 GN=celN PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000365	0.998903	0.000245	0.000170	0.000159	0.000159

TMHMM  Annotations     

start	end
5	22