CAZyme Information: MGYG000000209_02927

Basic Information

• Species: Eubacterium_F sp003491505
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eubacterium_F; Eubacterium_F sp003491505
• CAZyme ID: MGYG000000209_02927
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1162		127783.17	9.4472

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000209	3107681	Isolate	China	Asia

• Gene Location: Start: 1893; End: 5381 Strand: +

Full Sequence      

MNVRRYQKWAKSGLAIMLAGAMMVGTAASGGGMTAQAAETESSDTVSTQKAVTSDAASLL
FTEKHITSDLTLPTIGASGTTISWKSSNPSVLSNEGKVTRPKKGAADEEVTLKGTVKMGD
YAKARKFAFVVLAESEMGPTKEFALDQVELLDDYYLTAQNSDIEFLKKFDNDRLLSRFRE
TAGLDTKKIAPYGGWEDGWLGGHSVGHYLTAIAQAVKATGNADLKEKSKQLIKGLAECQN
KLGTGFIFGAKIETEGYVEKQFDILEGKTTGKTWVPWYNMHKMLTGLVDTYKYTGNKQAL
EVAKKLGDWIYNRVSKWDAGTQGRVLGTEYGGMNDCLYELYLCTRDSKHLEAAHKFDEPN
LYKTVAKGGKNCLNGKHANTTIPKFLGALKRYVVLEQTGELTKDDEAYLTNVEKFFDIAV
TRHAYITGGVSVMEHFRKDNNQDGTRTQTNCESCCAHNMLKMAKELYKVTGDKKYADYYE
TTLRNSIMGAVKSESGAAAYFIPMATGYFKTFGNEDPAKNMFWCCTGSGMENFTKLGDSI
YFHANDTLIVNQYVSSKVTWEEKNLVVTQKSDVTKSDKATFTVNAKDGSTIPSAALALRV
PDWMHGKAVVTVNGQEEKAAFSSGGYILLDREWKDGDVVTMEYPMSVDAFGLPDNNTVFA
FRYGPTVLAARLGKEKMASTTWAGANLTAPLYKVVGDQNQKITIKYGESKAATPLGNETL
TIQEDMSTIEFIDHIDNYLVKDTTSGTLAFKLKGTNADTTFNGGLQFVPFNKLNDERYGI
YWYFDTKYTESDEKQILTAKENGRLDASILDSTQPGYGQYERDVIHQLQEKDSVAGTITD
GGSTRYAKAGGYFTYNFIVNPDKGNALLCQFAKEDNGKTIKVMVGDKQIASKKLAYDGTA
AFYTEYINIPDDVLKKNVKKIVPEGDTKEYTVVSVRFESGSDAEDSARLVGGLYMTQSFS
DQAVLNTLTSSAGEVSSANDTFTIVVPKGTTSVALKYGIADQFGLLYVNDKLVDDTKQQT
YELTAAPLSLKVKVYAEDHKTVRDYSVVIKVKEDDVKKDDTPKNNSGSSQNTATPKSSNT
SKKKVSISITGKKSVKKGKTITLKVKKKNVKGKAKWSVNKKKLAKLKKKSATKVVLKARK
KGKVKVTVKVGKLKATKTITIK

Enzyme Prediction     

No EC number prediction in MGYG000000209_02927.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	147	669	5.9e-174	0.9980119284294234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	3.08e-144	147	669	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	7.27e-82	158	721	22	552	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam16375	DUF4986	5.66e-05	733	782	37	84	Domain of unknown function. This family around 150 residues locates in the C-terminal of some uncharacterized proteins in various Bacteroides and Bacillus species. The function of this family remains unknown.
cd04792	LanM-like	7.13e-04	259	355	585	678	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL17203.1	4.86e-208	141	955	37	815
ADL33431.1	2.67e-199	141	955	3	777
ANY68649.1	2.20e-197	70	1050	283	1210
QSF44176.1	6.73e-184	142	1049	18	858
AIQ49068.1	7.94e-182	142	1049	18	858

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	1.85e-99	143	887	28	749	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	5.48e-95	143	887	28	749	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
6EX6_A	1.51e-24	278	645	143	517	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
3WRE_A	9.83e-11	253	647	113	540	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]
3WKW_A	9.95e-11	253	647	113	540	Crystalstructure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum ligand free form [Bifidobacterium longum subsp. longum JCM 1217],3WKX_A Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum arabinose complex form [Bifidobacterium longum subsp. longum JCM 1217],7BZL_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7DIF_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXV_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXW_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	5.39e-10	253	647	113	540	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000789	0.998116	0.000297	0.000321	0.000246	0.000206

TMHMM  Annotations     

start	end
13	35