CAZyme Information: MGYG000000211_00158

Basic Information

• Species: Bacteroides sp900556215
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900556215
• CAZyme ID: MGYG000000211_00158
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
777		86476.77	5.3323

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000211	6486320	Isolate	China	Asia

• Gene Location: Start: 239635; End: 241968 Strand: +

Full Sequence      

MSRKLILSVALSGLVSTAMAQTTVAPAIPRDENIEKKVETLLKKMTLEEKIGQMTELTID
VITKRDNPTKEFQIDDALLDTVIGKYKVGSILNVPQGIAQSKEKWEEIIKKIQDKSMKTM
GIPCIYGVDQIHGTTYTLGGTFFPQGINMAATFNRELVREGARISAYETKAGSIPWTYAP
VLDLARDARWPRHWENYGEDCYVNAEMGREAVLGFQGSDPNNIGKQQVAACIKHYMGYGV
PVSGKDRTPSSITVQDMREKHFAPFLEGIKAGALSVMVNSAMNNGLPFHANYELLTQWLK
EDLNWDGMIVTDWADINNLYTRDKIVGSKKEAIKVAINAGIDMSMVPYEWSFCIYLKELV
EEGEVPMSRIDDAVRRVLRMKYRLGLFDTPAYRHQDFPLFGGKEHATAALRAAEESVVLL
KNTEGILPLVSGKKILLTGPNANSMRTLNGGWSYTWQGDRADECATDYNTILESFTNKFG
ASNIIYEPGVTYKQGGAWWEENAPEIDKAVTAATNADYIVACIGENSYCETPGNLSNLFL
SKNQLDLVKALATTGKPIILVLNEGRPRIINEIEPLAKAVINAMLPGNYGGDALANLVAG
DANFSAKMPYTYPREINSLFTYDYKPCEDLEKMQGAYDYDAVMSVQWAFGYGLSYTTYAY
SNLKVDKPYFTADDILTFTVDVKNTGNRIGKESVLLFSSDLIASLTPDVRRLRAFEKVEL
RPGEVKTVTLKVKGSDLAFVGYDGKWILEKGDFCIQTGNQTLNITCTDTRKWDTPNK

Enzyme Prediction     

EC	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	117	346	3.5e-64	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	1.05e-143	1	758	1	751	beta-glucosidase BglX.
COG1472	BglX	1.21e-81	45	462	1	380	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	1.88e-70	46	380	1	316	Glycosyl hydrolase family 3 N terminal domain.
PLN03080	PLN03080	1.18e-59	110	759	64	770	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	6.24e-48	417	655	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO68028.1	0.0	1	777	1	777
QUT89296.1	0.0	1	777	1	777
ALJ59663.1	0.0	1	777	1	777
QUT65958.1	0.0	1	777	1	829
QUT37180.1	0.0	1	777	1	829

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JP0_A	0.0	23	777	2	759	Bacteroidesovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus],5JP0_B Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus]
5TF0_A	4.16e-106	32	767	7	746	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
5XXL_A	2.06e-104	32	764	8	744	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	1.10e-103	32	764	8	744	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
6R5I_A	3.03e-94	35	772	4	730	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXU3	0.0	3	777	5	781	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
Q23892	1.34e-155	38	764	80	818	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2
Q56078	2.36e-111	38	764	38	757	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	5.69e-107	38	764	38	757	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH0	3.39e-95	17	758	16	707	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000279	0.998992	0.000178	0.000184	0.000174	0.000152

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000211_00158.