CAZyme Information: MGYG000000211_00213

Basic Information

• Species: Bacteroides sp900556215
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900556215
• CAZyme ID: MGYG000000211_00213
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1026	MGYG000000211_1|CGC9	116917.73	6.5705

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000211	6486320	Isolate	China	Asia

• Gene Location: Start: 321648; End: 324728 Strand: +

Full Sequence      

MRYSTMKKTLLSLCLTCLLTTPAIAQTVQPEWQSQYAIGKNKLAPHTYIWPYANADAVGE
GNYEQSPYYMSLNGKWKFHWVKNPDHRPKDFYKPSFYTGGWADINVPGNWERQGYGTAIY
VNETYEFDDPLFNFKKNPPLVPYAENEVGSYRRTFTVPADWKDRRIVICCEGVISFYYIW
VNGHMLGYNQGSKTPAEWDITDYVQEGENTVALEVYRWSAGSYLECQDMWRLSGIERDVY
LYSTPRQFIADYKVTSSLDKKEYKEGIFGLDVTVEGSATGVSALAYSLEDTAGKIILQNE
IPVKSRGLSNFITFDEQSLPDVKRWSAEYPNLYTLILTLKDDAGHVTHLTGCKVGFRTSE
IKDGRFCINGVPVLIKGANRHEHSQLGRTVSKELMEEDIRLMKQHNLNTVRNSHYPTHPY
WYQLCDRYGLYVIDEANIESHGMGYGPASLAKDSTWLPAHMDRTRRMYERSKNHPAIVIW
SLGNEAGNGVNFERTYDYMKSIETTRPIQYERAEQNYNTDIYCRMYRSVEELLAYARQTE
PKVYRPFIMTEYLHAMGNSCGGLKEYMDVFETEPIVQGGCIWDWVDQSFREIDAGGRWYW
TYGGDYGPKNVPSFGNFCCNGLVNAVREPHPHLLEVKKAYQYIKTTLIDKSNLTLSIKNW
YDFTNLNAYTLHWQVVGDHGKVIVDGTRQVDAAPHATVEVALGAVRLPSDVREAYLNLSW
TPVDAAPFINTDYEVAYDQFVLSGNKNYRTPETKLSGKVEMNIDPETGALRSYIYNGKEL
LVSPVTLSLYRPVTDNDNREKVGGAKAWKKAGLDQLTQRALSVKTATHGGRAEVELLNVR
GEKVGTASFIYTLKKNGELDIQTHFVPDTTAVTSLARVGLTFEMPDTYSQVSYLGRGEHE
TYMDRKQSGKIGIYRTDVERMFHYYVRPQATGNRTDVRWMQLADEAGEGLVFRSDASFQF
SVIPFTDENLDAATHINQLRREGVVTVHLDAAQAGVGTATCGPGVLSQYRVPVQDYTFRF
TVRPLK

Enzyme Prediction     

No EC number prediction in MGYG000000211_00213.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	62	909	2.5e-218	0.9667553191489362

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09525	lacZ	0.0	32	997	17	998	beta-galactosidase.
PRK10340	ebgA	0.0	32	1025	4	1000	cryptic beta-D-galactosidase subunit alpha; Reviewed
COG3250	LacZ	1.39e-147	71	913	14	808	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
smart01038	Bgal_small_N	2.09e-100	756	1021	2	271	Beta galactosidase small chain. This domain comprises the small chain of dimeric beta-galactosidases EC:3.2.1.23. This domain is also found in single chain beta-galactosidase.
pfam02836	Glyco_hydro_2_C	3.82e-99	360	644	2	301	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT89374.1	0.0	1	1026	1	1026
ALJ59590.1	0.0	1	1026	1	1026
QDO67973.1	0.0	29	1026	22	1019
ADV42494.1	0.0	6	1026	1	1025
ALK86826.1	0.0	6	1026	1	1019

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3BGA_A	0.0	30	1026	8	1002	Crystalstructure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],3BGA_B Crystal structure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]
3DEC_A	0.0	29	1026	4	998	ChainA, Beta-galactosidase [Bacteroides thetaiotaomicron VPI-5482]
6S6Z_A	3.06e-231	31	1023	3	980	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	3.15e-231	31	1023	4	981	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
1JZ7_A	2.06e-167	18	1019	4	1017	E.COLI (lacZ) BETA-GALACTOSIDASE IN COMPLEX WITH GALACTOSE [Escherichia coli],1JZ7_B E. COLI (lacZ) BETA-GALACTOSIDASE IN COMPLEX WITH GALACTOSE [Escherichia coli],1JZ7_C E. COLI (lacZ) BETA-GALACTOSIDASE IN COMPLEX WITH GALACTOSE [Escherichia coli],1JZ7_D E. COLI (lacZ) BETA-GALACTOSIDASE IN COMPLEX WITH GALACTOSE [Escherichia coli],4TTG_A Beta-galactosidase (E. coli) in the presence of potassium chloride. [Escherichia coli],4TTG_B Beta-galactosidase (E. coli) in the presence of potassium chloride. [Escherichia coli],4TTG_C Beta-galactosidase (E. coli) in the presence of potassium chloride. [Escherichia coli],4TTG_D Beta-galactosidase (E. coli) in the presence of potassium chloride. [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56307	1.73e-230	31	1023	4	981	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
O52847	2.04e-224	30	1025	18	1034	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1
Q47077	1.16e-185	21	1024	4	1028	Beta-galactosidase OS=Enterobacter cloacae OX=550 GN=lacZ PE=3 SV=1
Q2XQU3	6.55e-185	71	1024	55	1029	Beta-galactosidase 2 OS=Enterobacter cloacae OX=550 GN=lacZ PE=3 SV=1
Q6LL68	1.45e-183	31	1024	11	1027	Beta-galactosidase OS=Photobacterium profundum (strain SS9) OX=298386 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000302	0.998938	0.000241	0.000186	0.000169	0.000149

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000211_00213.