CAZyme Information: MGYG000000211_00254

Basic Information

• Species: Bacteroides sp900556215
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900556215
• CAZyme ID: MGYG000000211_00254
• CAZy Family: CE15
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
309	MGYG000000211_1|CGC11	33605.79	9.8004

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000211	6486320	Isolate	China	Asia

• Gene Location: Start: 391150; End: 392079 Strand: -

Full Sequence      

MKNRKTHLLALIMLLSIGMGTSAFAQKIPLVYNVENTGIKNLSPVLPGINELPVVKPLTD
PFQWSDGSGRSTNFKDWSRRRAEIAREIEHYEIGEKPVVSKKDITADIVDDTLRVNVTVN
GQTLALKAKISYPEGKGPFPAIIGIGRGTGSLPPVIFMSRNIAQIAFNFTQVMSHTQKRG
NEPINKLYPDQTDMGAYCAWSWGVSRIIDGLEIVGKKSKIDTRKLAISGCSFAGKMALFA
GAFDERIALTIAQEPGGGGAAAWRVSETLGEVETRTMYGSLTSRVMSPAVPPARYGEPSV
LPTEWASLL

Enzyme Prediction     

No EC number prediction in MGYG000000211_00254.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE15	58	271	3e-46	0.6096654275092936

CDD Domains     

MGYG000000211_00254 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ59535.1	1.00e-179	1	274	1	274
QUT89422.1	9.51e-178	1	274	1	274
QUT46099.1	5.85e-119	1	278	1	279
QRQ48279.1	5.85e-119	1	278	1	279
EFV29552.1	6.44e-118	1	278	1	279

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4G4G_A	3.12e-39	58	267	59	263	Crystalstructure of recombinant glucuronoyl esterase from Sporotrichum thermophile determined at 1.55 A resolution [Thermothelomyces thermophilus ATCC 42464]
4G4I_A	8.41e-39	58	267	59	263	Crystalstructure of glucuronoyl esterase S213A mutant from Sporotrichum thermophile determined at 1.9 A resolution [Thermothelomyces thermophilus ATCC 42464],4G4J_A Crystal structure of glucuronoyl esterase S213A mutant from Sporotrichum thermophile in complex with methyl 4-O-methyl-beta-D-glucopyranuronate determined at 2.35 A resolution [Thermothelomyces thermophilus ATCC 42464]
3PIC_A	1.60e-37	46	269	14	231	ChainA, Cip2 [Trichoderma reesei],3PIC_B Chain B, Cip2 [Trichoderma reesei],3PIC_C Chain C, Cip2 [Trichoderma reesei]
6RU2_A	1.97e-32	58	267	18	228	CrystalStructure of Glucuronoyl Esterase from Cerrena unicolor [Cerrena unicolor],6RU2_B Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor [Cerrena unicolor]
6RTV_A	5.10e-32	58	267	24	234	CrystalStructure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant [Cerrena unicolor],6RTV_B Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant [Cerrena unicolor],6RU1_A Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant in complex with the aldouronic acid Um4X [Cerrena unicolor],6RU1_B Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant in complex with the aldouronic acid Um4X [Cerrena unicolor],6RV7_A Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant in complex with the aldouronic acid UXXR [Cerrena unicolor],6RV7_B Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant in complex with the aldouronic acid UXXR [Cerrena unicolor],6RV9_A Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant in complex with the aldouronic acid XUXXR [Cerrena unicolor],6RV9_B Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant in complex with the aldouronic acid XUXXR [Cerrena unicolor]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2QJR6	1.17e-40	22	267	13	249	4-O-methyl-glucuronoyl methylesterase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=ge2 PE=1 SV=1
Q7S1X0	2.31e-38	55	268	40	248	4-O-methyl-glucuronoyl methylesterase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=Cip2 PE=1 SV=2
B2ABS0	9.52e-37	53	266	118	328	4-O-methyl-glucuronoyl methylesterase OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) OX=515849 GN=ge1 PE=1 SV=1
G0RV93	3.64e-36	46	269	99	316	4-O-methyl-glucuronoyl methylesterase OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=cip2 PE=1 SV=1
A0A0A7EQR3	2.72e-31	58	267	112	322	4-O-methyl-glucuronoyl methylesterase OS=Cerrena unicolor OX=90312 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000380	0.998810	0.000235	0.000205	0.000171	0.000160

TMHMM  Annotations     

start	end
7	24