CAZyme Information: MGYG000000211_00345

Basic Information

• Species: Bacteroides sp900556215
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900556215
• CAZyme ID: MGYG000000211_00345
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
954	MGYG000000211_1|CGC13	105894.28	6.2577

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000211	6486320	Isolate	China	Asia

• Gene Location: Start: 519810; End: 522674 Strand: +

Full Sequence      

MNLKRHLFLFAGILSCSFLMAQQPSDILSVSASTNVEKASLAFDKDQKTMWEVSGQDLKT
DQWLMFTIQTSGDVCELGVQMQGVSKEDLKQLMNIFVTYDPMNLGVPVDYQIQGSAKEMR
LKFSPKYGAHVRLAFKGGDRVKPFMVKEVSVLLADKELKDLKGEKTSLRYMDPTLPVEER
VESLLSVMTPEDKMELIREGWGIPGIPHLYVPPITKVEAVHGFSYGSGATIFPQALGMGA
TWNKKLTEEVAMAVGNETLSAGTMQAWSPVLDVAQDARWGRCEETFGEDPVLVSQIGGAW
IKGYQSMGLYTTPKHFGGHGAPLGGRDSHDIGLSEREMREVHLVPFRHVIRNYDCQSLMM
AYSDFLGVPVAKSRELLHNILREEWGFSGFIVSDCGAIGNLTARKHYTAKDKIEAANQAL
AAGIATNCGDTYNDKEVIQAAKDGRINMENLEEVCRTMLRMMFRNELFEKAPNKPLDWNK
IYPGWNSDSHKEMARQAARESIVMLENKDNILPLSKNMRTIAVLGPGADDLQPGDYTPKL
LPGQLKSVLTGIKQAVGKQTKVVYEQGCDFTSLGENNIAKAVKVASQSDVVLLVLGDCST
SEATTDVYKTSGENHDYATLILPGKQQELLEAVCATGKPVILILQAGRPYNLSKASELCK
AILVNWLPGQEGGPATADVLFGDYNPAGRLPMTFPRHVGQLPLYYNFKTSGRRYEYSDME
YYPLYYFGYGLSYTSFEYSGLKVQEKENGNISVQVTVKNIGQRAGDEVVQLYVTDMYASV
KTRITELKDFTRIHLKPGEAKTVSFELTPYELSLLNDHMDRVIEKGAFKILVGGVSPQYV
AKDRIKDSVGYADSKKGLSGMLEYTHEFAADFGLTLFKVEENLVKNQKTIWVSVKNNGTL
MDTGKIEMYVGGNKVGDNVHYELAPGEEKLIPFSVDKENTAPVVFTTKYKVLSI

Enzyme Prediction     

No EC number prediction in MGYG000000211_00345.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	206	426	5.3e-68	0.9675925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	2.07e-163	230	833	118	751	beta-glucosidase BglX.
PLN03080	PLN03080	1.35e-101	170	833	42	769	Probable beta-xylosidase; Provisional
COG1472	BglX	4.05e-79	195	561	44	392	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	1.10e-69	502	733	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	2.09e-54	209	461	64	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO67869.1	0.0	1	954	1	954
QUT89549.1	0.0	1	954	1	954
QRQ47314.1	0.0	1	954	1	954
QUT46488.1	0.0	1	954	1	954
QQA09894.1	0.0	1	954	1	954

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YOT_A	1.37e-120	169	836	6	745	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	1.03e-119	169	836	6	745	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
6R5I_A	2.48e-109	216	838	71	724	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5O_A	1.31e-108	216	838	71	724	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5O_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5R_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5R_A	1.34e-108	216	838	72	725	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	7.66e-135	177	836	33	710	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
P33363	6.12e-117	206	833	99	751	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
Q56078	3.26e-116	180	833	76	751	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P14002	2.74e-96	181	846	5	667	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
T2KMH9	1.43e-93	153	839	75	747	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001573	0.561918	0.435543	0.000396	0.000278	0.000266

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000211_00345.