CAZyme Information: MGYG000000211_00457

Basic Information

• Species: Bacteroides sp900556215
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900556215
• CAZyme ID: MGYG000000211_00457
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1049		116054.01	9.4049

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000211	6486320	Isolate	China	Asia

• Gene Location: Start: 684805; End: 687954 Strand: +

Full Sequence      

MKKLFLLFLMICSCCVRFDAQAHHLPAPQSPVPPVEPIMIRSVSNDERCRQWVDSVLNRM
NLKERIGQLFIYTIAPQQDKANRDLLRKVVDDYKVGGLLFSGGLMENQAILTNEAQKMAD
VPLMITFDGEWGLSMRLRGTPVFPRNMILGCIQNDSLLYEYGREMARQCRELGVQVNFAP
VADVNINPKNPVINTRSFGESPANVADKVIAYARGLEDGGVLSVSKHFPGHGDTDVDSHH
SLPKLTFSRARLDSVELYPFKKAIQAGLSGMMVGHLEVPVLESKRGVPSSLSRSVVHDLL
TQEMKFQGLVFTDALAMKGVSANNTSICLQALKAGHDLLLVPRRIKEEVDAILDAVKNGE
LTEAEVEAKCRKVLTYKYALGLSKKPFVRLSGLSNRINTAHTRDLIRRLNQEAITVLKNK
NDLLPLDADTREVAVLNVGDAKEIQPFLKELSEFINPVGSKGVPAVFQLKKELPVAARKQ
LRDSLSQYKRILVCVTEHRLAPYQTFFGEFVPDIPTAYLLFIPGKQMLQIRRAVSAANAV
VLAHSSNDDVQCQVARILYAGATANGRLSASVSDLFATGDGRTITPKTPLHFVPDEHGMN
SRLLTRIDEIAKEGIKEGAYPGCQIVILKDGKEMYNKAFGTHTWPGATGASVNKLSATNI
PGATLSVSSTDVYDLASLTKTTATLLAVMKLYDKGRLNLTDRVSDYLPWLQDTDKKDITV
RQLLLHESGLPSTLLFYQEAIDKESYGGTLFKAKPDAAHSVQIGVRTWANPKFKFQKGLT
SKVRTAEHTLQVADSLWLNRSFKEVYQQTIVKAPLRDRRYRYSCVGFILLQQLVEARTGM
SMDAFLEQEFYAPMGLKRTGYLPLKGAATAGTAYAGIVSGKHTPIPKAEIIPSSVDLFLR
KTVLQGFVHDESAAFQGGVSGNAGLFSNATEVAQIYQMLLNGGELDGKRYLSPETCRVFT
TTVSRISRRGLGFDKPDRQNPAKSPCAMAAPATVYGHTGFTGTCAWVDPTNGLVYVFLCN
RIYPDVWNTKLMKMDIRTRIQEVMYQALK

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	115	341	3.9e-55	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	8.11e-79	60	436	1	360	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	2.95e-76	62	375	2	315	Glycosyl hydrolase family 3 N terminal domain.
PRK03642	PRK03642	5.47e-53	594	1049	30	432	putative periplasmic esterase; Provisional
pfam00144	Beta-lactamase	1.17e-38	607	1026	1	313	Beta-lactamase. This family appears to be distantly related to pfam00905 and PF00768 D-alanyl-D-alanine carboxypeptidase.
COG1680	AmpC	2.50e-37	569	1025	1	367	CubicO group peptidase, beta-lactamase class C family [Defense mechanisms].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO71487.1	0.0	1	1049	1	1049
ALJ59284.1	0.0	1	1049	1	1046
QUT89658.1	0.0	1	1049	1	1046
QUT62072.1	0.0	1	1048	1	1009
QQA30538.1	0.0	1	1048	1	1009

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K5J_A	3.13e-61	60	573	11	532	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	1.41e-58	54	425	36	446	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	4.04e-58	54	425	10	420	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	7.13e-58	54	425	40	450	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
3SQL_A	1.68e-53	30	394	7	362	CrystalStructure of Glycoside Hydrolase from Synechococcus [Synechococcus sp. PCC 7002],3SQL_B Crystal Structure of Glycoside Hydrolase from Synechococcus [Synechococcus sp. PCC 7002],3SQM_A Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_B Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_C Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_D Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40406	7.69e-58	54	425	36	446	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
P48823	3.00e-45	86	443	55	441	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
P77619	1.49e-38	594	1026	30	400	Putative D-alanyl-D-alanine carboxypeptidase OS=Escherichia coli (strain K12) OX=83333 GN=yfeW PE=1 SV=2
Q8XBJ0	3.01e-37	594	1026	30	400	Putative D-alanyl-D-alanine carboxypeptidase OS=Escherichia coli O157:H7 OX=83334 GN=yfeW PE=3 SV=1
Q7WUL3	1.77e-35	52	432	18	401	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000705	0.698080	0.300315	0.000339	0.000294	0.000247

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000211_00457.