CAZyme Information: MGYG000000211_00463

Basic Information

• Species: Bacteroides sp900556215
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900556215
• CAZyme ID: MGYG000000211_00463
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
765	MGYG000000211_1|CGC15	85526.59	5.5628

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000211	6486320	Isolate	China	Asia

• Gene Location: Start: 692100; End: 694397 Strand: +

Full Sequence      

MKKIIATMAIGACLCSCGGSREEVYKDPSATVKDRVEDLLKRMTLEEKVGQMNQFVGVEH
IKANSAVMTEDELRNNTANAFYPGFTEKDIEKWTEEGLIGSFLHVLTIEEANYLQSLAMK
SRLQIPIIFGIDAIHGNANAPDNTVYPTNINLACSFDTLMAYKIARQTAREMRAMNMHWT
FNPNVEVARDARWGRVGETYGEDPYLVTLLGVQSVKGYQGNLNGSEDVLACIKHFVGGSE
PINGTNGSPTDLSERTLREVFFPPFEAGVKAGAMSLMTAHNELNGIPCHSNEWLMQDVLR
SEWKFPGFVVSDWMDIEHIHDLHATAENLKEAFYQSIMGGIDMHMHGIHWNEMVVELVKE
GRIPESRIDESVRRILDIKFRLGIFEQPYADEARTTQVRLCDEHRVTALEAARNGIVLLK
NDGVLPLSHSKYKRIMVTGINADDQNILGDWSAPAKDENVTTILEGLKMISPDTQFDFVD
QGWDPRNMDPKKVFEAAARARTADLNIVVAGEYMMRFRWNDRTDGEDTDRSDLDLVGLQN
ELIEKVAASGKPTILILVNGRPLGVWAAENLSAIIEAWAPGMYGGQAVAEILYGKVNPSA
KLAVTIPHSVGQLQMIYNHKPSQYFHPYVAGKPNKPLYPFGYGLSYTTYKYGDLKLMQKE
IGTDGAVDVSVKVTNTGDRDGVEIVQLYIRDKFSSVTRPVKELKDFARVSLKAGESKVVN
FRITPDKLAFYDKKMKKVVEPGEFIVMVGASSNDKDLLTETFTVR

Enzyme Prediction     

No EC number prediction in MGYG000000211_00463.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	119	345	7.8e-73	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	1	754	1	756	beta-glucosidase BglX.
COG1472	BglX	4.43e-96	43	453	1	373	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	8.63e-83	144	749	112	769	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	7.49e-77	44	376	1	314	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	7.51e-61	416	646	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT89663.1	0.0	8	765	1	759
ALJ59279.1	0.0	8	765	1	759
ADV42268.1	0.0	24	764	6	748
AIA99588.1	0.0	1	765	1	768
AFH08276.1	0.0	1	765	1	768

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Z9S_A	1.67e-145	25	764	17	787	Functionaland Structural Characterization of a beta-Glucosidase Involved in Saponin Metabolism from Intestinal Bacteria [Bifidobacterium longum],5Z9S_B Functional and Structural Characterization of a beta-Glucosidase Involved in Saponin Metabolism from Intestinal Bacteria [Bifidobacterium longum]
5TF0_A	2.43e-142	36	752	13	740	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
5XXL_A	2.67e-140	36	765	14	752	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	1.47e-139	36	765	14	752	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5Z87_A	2.92e-135	115	754	113	776	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	7.72e-150	99	765	37	723	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
Q56078	1.31e-134	36	752	38	754	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	7.18e-134	36	752	38	754	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH9	8.45e-129	1	754	1	746	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
A7LXU3	5.98e-110	2	749	6	762	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000014	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000211_00463.