CAZyme Information: MGYG000000211_00469

Basic Information

• Species: Bacteroides sp900556215
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900556215
• CAZyme ID: MGYG000000211_00469
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
371	MGYG000000211_1|CGC15	42681.57	6.5622

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000211	6486320	Isolate	China	Asia

• Gene Location: Start: 701615; End: 702730 Strand: +

Full Sequence      

MKLKLILIICLPSFLGLNLKAQSLVDNEATTETKALYRNLSELAGKHILFGQQDATNYGH
DWSVGENRSDIKDVCGSHPAMIGDDFDKLTVKDEKRLEEGRKHLLKTITDTYERGGVITI
CWHSVNPVNGGSFYWEKNPVEAVAHILPGGTKHQQYLLYLDRIAEVAHEAKGKGGELIPI
IFRPFHEFDGDWFWWGSAHCTKKEFICLWRFTVDYLKDTKLVHNFLYAFSPDCKFTTEKE
YLERYPGDKYVDILGTDNYWDFRPDGANNPKLAVDKLKIVSDIAKNKQKLAALTETGLEG
VTNPEWYTSVLLPILKNPAIKLAYVMVWRNANYNPNHYYAPFSGHPAEDDFRKFKEDSQI
YFEDRLPDLYK

Enzyme Prediction     

No EC number prediction in MGYG000000211_00469.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	25	333	3.8e-67	0.9141914191419142

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	5.38e-36	25	259	1	230	Glycosyl hydrolase family 26.
COG4124	ManB2	8.45e-15	178	300	180	299	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARK08556.1	6.68e-163	24	371	25	371
QIK56190.1	2.27e-162	24	370	24	369
QIK61608.1	2.14e-160	24	370	24	369
AIA99595.1	3.22e-148	49	371	1	321
QHT66668.1	1.02e-138	22	371	26	377

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VX4_A	3.08e-94	23	371	32	396	CellvibrioJaponicus Mannanase Cjman26c Native Form [Cellvibrio japonicus],2VX6_A CELLVIBRIO JAPONICUS MANNANASE CJMAN26C Gal1Man4-BOUND FORM [Cellvibrio japonicus]
2VX5_A	6.16e-94	23	370	32	395	CellvibrioJaponicus Mannanase Cjman26c Mannose-Bound Form [Cellvibrio japonicus]
4CD4_A	6.17e-94	23	371	55	419	Thestructure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManIFG [Cellvibrio japonicus Ueda107],4CD5_A The structure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManMIm [Cellvibrio japonicus Ueda107]
2VX7_A	2.46e-93	23	371	32	396	CellvibrioJaponicus Mannanase Cjman26c Mannobiose-Bound Form [Cellvibrio japonicus]
4ZXO_A	3.00e-86	28	371	7	344	Thestructure of a GH26 beta-mannanase from Bacteroides ovatus, BoMan26A. [Bacteroides ovatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49424	7.62e-54	9	371	20	416	Mannan endo-1,4-beta-mannosidase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=manA PE=1 SV=2
A1A278	3.22e-52	26	359	44	391	Mannan endo-1,4-beta-mannosidase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) OX=367928 GN=BAD_1030 PE=1 SV=1
P49425	1.95e-19	24	297	146	408	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
O05512	8.96e-18	25	330	32	326	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuG PE=1 SV=2
G2Q4H7	1.35e-17	22	292	172	420	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000337	0.998599	0.000517	0.000178	0.000177	0.000158

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000211_00469.