CAZyme Information: MGYG000000211_00783

Basic Information

• Species: Bacteroides sp900556215
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900556215
• CAZyme ID: MGYG000000211_00783
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
750	MGYG000000211_2|CGC6	81179.11	5.2994

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000211	6486320	Isolate	China	Asia

• Gene Location: Start: 273557; End: 275809 Strand: -

Full Sequence      

MKARRIFSTCLLLLPFVSCTQVANKGSDAATEKKVESLLSKMTLEEKIGQMNQITSYGNI
EDMSSLIKKGEVGSILNEVDPVRINALQRVAMEESRLGIPLLIARDVIHGFKTIFPIPLG
QAASFNPQIAKDGARVAAIEASSVGIRWTFAPMIDIARDPRWGRIAEGCGEDTYLTSVMG
AAMVEGFQGDSLNSSTSIAACPKHFVGYGAAEGGRDYNSTFIPERRLRNVYLPPFEAAAK
AGAATFMTSFNDNDGIPSTGNAFILKDVLRGEWGFDGLVVTDWASASEMISHGFAADSKE
VAMKSVNAGVDMEMVSYTFVKELPALIKEGKVKESTIDEAVRNILRVKYRLGLFDAPYVD
EKQPSVMYTPSHLKVAKQAAVESAILLKNDKEVLPLQESLKTVAVVGPMANAPYEQLGTW
IFDGEKAHTQTPLNAIKEMVGDKVQVIYEPGLAYSREKNLAGVAKAAAAAARADVILAFV
GEEAILSGEAHCLADLNLQGDQSALITALAKTGKPVVTIVMAGRPLTIGQEVEESTAVLY
SFHPGTMGGPALADLLWGKAVPSGKTPVTFPKMVGQIPVYYAHNNTGRPATRNEVLLDDI
AVEAGQTSLGCTSFYMDAGFDPLFPFGYGLSYTTFKYSNVKLSSASLKKDDVLTVTFDLE
NTGKYKGTEVAQLYIQDKVGSVTRPVKELKRFTRVTLKPGEKKNVSFELPISELAFWNID
MVKVVEPGDFGLWVATDSQSGEEVFFKVVD

Enzyme Prediction     

EC	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	92	315	4.1e-72	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	35	746	38	762	beta-glucosidase BglX.
COG1472	BglX	2.76e-112	42	444	1	391	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	3.23e-93	43	347	1	316	Glycosyl hydrolase family 3 N terminal domain.
PLN03080	PLN03080	9.18e-69	9	750	6	778	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	3.86e-50	384	632	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO69450.1	0.0	1	750	1	750
ALJ61573.1	0.0	1	750	1	750
SIP56440.1	0.0	1	750	1	750
QUT92858.1	0.0	1	750	1	750
SIP56336.1	0.0	1	750	1	750

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XXL_A	3.18e-198	22	748	1	751	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	1.80e-197	22	748	1	751	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5TF0_A	7.84e-191	23	740	1	742	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
6R5I_A	4.54e-173	32	749	4	733	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5P_A	8.57e-173	26	749	28	765	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5P_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56078	1.47e-194	30	749	33	765	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	7.44e-192	30	749	33	765	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
A7LXU3	8.24e-134	27	730	31	757	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
T2KMH0	3.44e-128	11	742	9	714	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
T2KMH9	3.42e-122	16	748	16	754	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000015	0.005061	0.994942	0.000002	0.000003	0.000002

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000211_00783.