CAZyme Information: MGYG000000211_01251

Basic Information

• Species: Bacteroides sp900556215
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900556215
• CAZyme ID: MGYG000000211_01251
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
365	MGYG000000211_3|CGC4	41775.05	7.7599

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000211	6486320	Isolate	China	Asia

• Gene Location: Start: 127667; End: 128764 Strand: -

Full Sequence      

MKKILVLFLFSVGCSLYAQQFSADMKKTDIMKVCDAVAKWQINHQKEVKHHPLDWTNGAL
YRGMTEWGKVSGNETCYDFVREIGEKYNWNMWDRVYHADDICVGQAFIEMYRKLGDKRML
QPVMERAYYVATHPSKAPLLKTDAVGTLERWSWADALFMAPPVYAALYTMTGDDVYLNYM
NSEYKECVDSLYDEECSLFYRDNKRIPLREKNGAKQFWGRGNGWVFAGLPLIIDNLPIDC
GSRNYYIQLFVKMAEALRKTQCEGGDWRTSLLDPDSYDMPENSCSAFMCYGIAWGLRNEY
LAKRTYKPVLEKGWKSLVKAVHTDGKLGYIQPVGAAPKAAGRDATDVYGVGAFLLAGSEL
YKLIK

Enzyme Prediction     

No EC number prediction in MGYG000000211_01251.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	48	362	2.1e-80	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	8.93e-85	35	363	3	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	5.54e-49	54	363	35	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO70976.1	9.02e-282	1	365	1	365
QDH57430.1	8.65e-240	1	364	1	365
QUT45004.1	6.35e-239	1	365	1	366
QRQ49255.1	1.28e-238	1	365	1	366
QRQ48187.1	1.66e-220	1	362	1	363

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CE7_A	4.23e-74	21	363	24	369	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
5NOA_A	4.99e-53	12	365	14	376	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	2.59e-44	39	365	26	359	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
1NC5_A	2.19e-10	58	365	44	369	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	8.97e-10	58	365	34	359	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WF04	6.29e-75	32	360	59	408	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
L7P9J4	2.83e-73	21	363	31	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	1.09e-69	11	363	18	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
O34559	1.20e-09	58	365	44	369	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000596	0.598984	0.399709	0.000256	0.000232	0.000206

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000211_01251.