CAZyme Information: MGYG000000211_01373

Basic Information

• Species: Bacteroides sp900556215
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900556215
• CAZyme ID: MGYG000000211_01373
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
432	MGYG000000211_3|CGC6	50028.14	7.3788

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000211	6486320	Isolate	China	Asia

• Gene Location: Start: 268283; End: 269581 Strand: -

Full Sequence      

MKKIYTYLIFSLALLCSTSLIAQTNEKARETAVMIADRILKSTTYDFVDKKSGKTYTSLK
NVPLNKNVKVQSKYLDWHYTNGVTNIALMELGDKLGTSKYENYVLKNMNFIFDDVNQDYF
HRLYDQTLEQEGWRAVNHVNWHMIYRNKRLDDNGPMGASLIVLNRRHPEQAFRKYIDQTD
HHLMVSEPRLADGTIARLWPHVNTIWADDAFMALSFLVRMGEVTGDTKYFDDAANQILNY
TRYLWCPEKGLYYHCYHTDNKAHGVAHWSRANGWVFMATADLLARMPAEHPMREDVIRNF
RMQADGLIRYQGANGLWHQLLDKEDSYEEITGTAMFVFGIARGVKQGWLHPDYIYVAWEG
LKGMFTKITPEGDVTAICAGTGIMPALSFYYNRPQWKNDPMGEGPVLRALVEMIDAPKYT
EIKAEQQYDKIK

Enzyme Prediction     

No EC number prediction in MGYG000000211_01373.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	72	414	9.5e-89	0.9728915662650602

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.05e-59	77	414	27	340	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	1.11e-55	26	413	2	353	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT90500.1	0.0	1	432	1	432
ALJ58381.1	0.0	1	432	1	432
QJR74994.1	1.60e-254	20	432	20	432
AII61958.1	1.60e-254	20	432	20	432
AND18844.1	4.58e-254	20	432	20	432

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K11_A	2.53e-49	24	414	28	411	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
4WU0_A	1.49e-26	77	412	23	357	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	1.92e-24	77	413	39	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
4XUV_A	1.92e-24	195	412	138	367	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
2GH4_A	7.95e-24	77	413	29	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	3.89e-28	131	418	45	340	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
O34559	1.05e-23	77	413	39	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	8.84e-14	212	414	1	229	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	8.84e-14	212	414	1	229	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000835	0.855185	0.143242	0.000255	0.000242	0.000219

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000211_01373.