CAZyme Information: MGYG000000211_02021

Basic Information

• Species: Bacteroides sp900556215
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900556215
• CAZyme ID: MGYG000000211_02021
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
775	MGYG000000211_4|CGC5	88508.99	6.8128

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000211	6486320	Isolate	China	Asia

• Gene Location: Start: 380004; End: 382331 Strand: +

Full Sequence      

MKKGFIGLVFLWVTQICCAQFSLRSDQPIKLACDNAEEKVVQTALKLFIRDYQSVFSASA
AVDARQGNIIVGTVGKSPLLKTVSADVSALAGKKQAFLLQVLPDGKLLVAGSDSHGTAYG
IMELSRLIGVSPWEWWADVTPEKKISFVLPAEYQTLQSPSVEYRGIFINDEDWGLMPWSS
QTYEPSDVKGHIGPKTNARIFELLLRLRANTYWPAMHECTLPFFLTEGNRKVAEEYGIFI
GSSHCEPMVCSAAGEWRRRGQGDYDYVNNSASVYKFWEDRVKEVAQQGNIYTLGMRGVHD
GQMQGAKTVAEQKAVLERVLKDQRGLLQKYVNKDVTTIPQAFIPYKEVLDIYNAGLQVPD
DVTLIWCDDNYGYIRHFPTAEERARKGGNGIYYHVSYWGRPHDYLWLGTFSPYLLHQQMK
LAYDRGIQKMWVLNVGDIKPAEYQIELFLDMAWNIDEVNEIGVTAHLKSWLEREFGSNCA
EELLPAMEAHYQLSYIRKPEFMGNTREEERDPKYKVIKDLPWSEQTISERLRSYTVLSDV
VERIESNIPADRQDAYFQLVKYPVQAAAQMNRKILTAQFARHSKADWKQSDAAFDSIASL
TQQYNSLQNGKWNRMMDFHPRKLPVFKRVEHTSATEPMMTDRKMLCKWNAMECTYGKPVP
YEGLGYERKAAGIRKGSSLTFAFDDYGKDSVEVEIRLLPSHPLDEKQLRFAISVDEAVPQ
TVSYETKGRSEEWKENVLRNQAIRKVTLPINKQASHKLVITALDEGVVLDQVILY

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	22	772	3.7e-246	0.9928263988522238

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	0.0	157	501	1	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	2.06e-18	675	775	54	159	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT89997.1	0.0	1	775	1	775
ALJ58886.1	0.0	1	775	1	775
EDV07550.1	0.0	1	775	1	774
ALJ39737.1	0.0	21	775	26	780
QQA08841.1	0.0	1	775	1	780

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5BY3_A	0.0	21	775	20	774	Anovel family GH115 4-O-Methyl-alpha-glucuronidase, BtGH115A, with specificity for decorated arabinogalactans [Bacteroides thetaiotaomicron VPI-5482]
4ZMH_A	9.17e-103	31	613	25	607	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
4C90_A	3.62e-99	28	641	52	657	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PXQ_A	4.02e-91	23	616	19	624	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PUG_A	4.10e-91	23	616	20	625	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000538	0.997839	0.001068	0.000179	0.000171	0.000175

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000211_02021.