CAZyme Information: MGYG000000211_03220

Basic Information

• Species: Bacteroides sp900556215
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900556215
• CAZyme ID: MGYG000000211_03220
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378	MGYG000000211_7|CGC1	43341.26	7.1479

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000211	6486320	Isolate	China	Asia

• Gene Location: Start: 18218; End: 19354 Strand: -

Full Sequence      

MKYYLIVGEASGDLHASHLMAALKVEDPQAEFRFFGGDLMAAVGGTMVKHYKELAYMGFI
PVLLHLRTIFANMKRCKEDIVAWQPDVVILVDYPGFNLSIAKFLRAKTHIPVYYYISPKI
WAWKEYRIKNIKRDVDELFSILPFEVEFFEDKHHYPIHYVGNPTVDEVTLFRAEHPETFD
DFIRENNLDSKPIIALLAGSRKQEIKDNLPDMLRAASAFPEYQLVLAGAPGISPDYYHEY
IGDAKVKILFGQTYRLLQQAEAALVTSGTATLETALFRVPQAVCYHTPIGKVISFLRRHI
LTVKYISLVNLIANREVVKELVADTMTVEQARAELERILYDKDYRQRMLDGYEYMTARLG
DAGAPKRAAQEMVHLLRK

Enzyme Prediction     

No EC number prediction in MGYG000000211_03220.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	358	2.1e-112	0.9858757062146892

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.56e-106	1	378	2	377	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	2.62e-93	1	378	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	6.26e-73	4	371	2	373	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	5.42e-64	5	375	10	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	3.69e-49	1	329	2	307	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO69124.1	1.49e-273	1	378	1	378
QUT93317.1	2.24e-265	1	376	1	376
ALJ61154.1	2.61e-264	1	376	1	376
QPH59250.1	7.59e-238	1	378	1	378
QMI80442.1	3.09e-237	1	378	1	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	2.53e-35	5	375	11	380	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	6.77e-35	5	375	11	380	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	1.30e-66	2	376	6	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
B3E4H8	3.14e-60	2	369	8	373	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q6ALW0	3.68e-59	5	369	14	379	Lipid-A-disaccharide synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) OX=177439 GN=lpxB PE=3 SV=1
Q2LVL8	9.47e-59	5	378	8	380	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q39T49	2.25e-56	2	378	8	382	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000211_03220.