CAZyme Information: MGYG000000211_03424

Basic Information

• Species: Bacteroides sp900556215
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900556215
• CAZyme ID: MGYG000000211_03424
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1229	MGYG000000211_7|CGC3	140317.35	6.3836

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000211	6486320	Isolate	China	Asia

• Gene Location: Start: 279250; End: 282939 Strand: -

Full Sequence      

MKNFYIAFWTAACLLISSSGYAQSEWKNNFSDQGEILKTVGRGECSIADGVFRSKGSYAC
FGNPEWKNYTMSFKARAPQEAEQVQIWAGFRANNRFDRYVVGLKGGLQDDLYLMRMGYMG
TDEFMGVRPLGFHPVPGQWYKLKVEVCGSRIRIFLNDEKEPRMDITDKNSNLAPSGPVTL
GGGWIETEFDDLVVTPLEEDALKDVKVTEYRKVVTPQEKENKRQFERANYTSVKVSELEE
GRTDISLNGNWLFMPGYQLDNKEKAISTTTDDKDWHVMSVPNFWNPIRIWLHGETMPSPT
GAQPKGVSDTYYQQETDRCEGYTFDYRKTNVAWYRQWVELPANIEGKNMTLTFDAVSKVA
EIYINGELAGSHIGMYGEIQVDGSKLLKPGRNLVAVKVTRRAEGSSSESGSAAIDFFYSS
VRESEQEGGKVSVKSNILKDIAHGFYGDDPAGIWQPVRLTITSPVKVEDIFIKPTLEGAT
FDLTAKNHGSKKSQFDLYTDVIDKETGSLLYSGLSLPKLVLNAGEEKVFTYSVNNLKPRL
WTPHHPNLYDFRFRLVAAKGAELDCMTETSGFRTFEVKEGLFFLNGNRYWLRGGNHIPFA
LAPNDLNLANTFMQLMKAGNMDVTRTHTTPWNKLWMGAADKNGIGVSFEGTWPWLMIHST
PLPDAKLIEMWKEEFLRLLKKYRNHPSLLFWTVNNEMKFYDNDNDLERAKEKYRVISDVV
KEMRRIDPTRPICFDSNYQAKGKDKKFGTDFMNSIDDGDIDDMHGYYNWYDFSVFRFFNG
EFQERYKMPDRPLISQEMSTGYPNNETGHPTRSYQLIHQNPQSLIGYECYDFSDPKYFLT
AQSFITGELAETLRRSNDQGSGILHFALLTWFRQVYDYQKIEPYPTYYALKRALQPVLVS
AELWGRNLYGGDKLSTRVYVVNDREDGTELKPTLLRWEIQDETGKKLVWGSEEVPVVKHY
GRHYIEPSIQLPTNLPADKINAKLVLKLTENGLPVSENEYHLVLARKSWNMNQISEGKKV
VLLDKDGMKDKLDFLHVKYQTVSSIKELVNSKLKADLCIISGLTECTDEEKELIRSYQSK
GGKLLLLNSKEVAKNIYPEHITGWIIPTEGDIVNMERNDAPVFDGIDVLELRYFNNNKRE
IPLACNATLKTNRNENLVELAGQMKIHAYIDGGKPEDRIRKIDSMRGFTLIQIKDGKGLA
TVSTMCTEKADTDPIAGKLLVNMISDLLK

Enzyme Prediction     

No EC number prediction in MGYG000000211_03424.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	226	1002	3.8e-86	0.7353723404255319

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	3.87e-30	245	901	13	636	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	4.78e-29	332	770	67	476	beta-D-glucuronidase; Provisional
PRK10340	ebgA	7.28e-21	247	744	44	484	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam02836	Glyco_hydro_2_C	1.83e-13	575	830	1	234	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam00703	Glyco_hydro_2	1.91e-10	465	573	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO68995.1	0.0	1	1229	1	1229
QUT46480.1	0.0	1	1229	1	1230
QRQ47307.1	0.0	1	1229	1	1230
ALJ60854.1	0.0	1	1229	1	1229
QUT88128.1	0.0	1	1229	1	1229

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6S6Z_A	8.09e-24	237	696	31	440	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	8.10e-24	237	696	32	441	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
5T98_A	4.14e-23	245	837	28	530	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
6ED1_A	5.90e-23	238	770	20	485	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei]
3GM8_A	4.74e-22	251	765	13	450	ChainA, Glycoside hydrolase family 2, candidate beta-glycosidase [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPJ7	1.22e-24	237	740	46	474	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
O52847	2.47e-23	246	696	60	481	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1
Q56307	4.44e-23	237	696	32	441	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
P77989	1.12e-22	241	729	2	412	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
A7KGA5	1.02e-18	239	752	41	500	Beta-galactosidase OS=Klebsiella pneumoniae OX=573 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000238	0.999157	0.000182	0.000140	0.000131	0.000124

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000211_03424.