CAZyme Information: MGYG000000211_04279

Basic Information

• Species: Bacteroides sp900556215
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900556215
• CAZyme ID: MGYG000000211_04279
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
778	MGYG000000211_10|CGC4	88339.92	5.9961

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000211	6486320	Isolate	China	Asia

• Gene Location: Start: 137586; End: 139922 Strand: +

Full Sequence      

MKNISLLLLLSLTILSSACKSESEKTVVADKVSMEAQPFPLSDLRLLPGSPFKHAMDKNG
EWLLDLSADRLLHRFRLNAGLTPKGEIYGGWESRGVSGHTLGHYLSACAMMYAASGDERY
KERVDYIIKELAECQDARKTGYVGGIPDEDKIWAEVSSGDIRSQGFDLNGGWVPWYTLHK
LWAGLIDAYRYGNNDQAKEVAVKLSDWAVNSFGNLSEESFQKMLACEFGGMNESFADMYA
ITGNENYLKLARQFYHKAILDPLKEQRDELEGKHSNTQVPKIIGEARLYELTGDKDMQTI
ATFYWDRIVNHHSYVNGGNSNYEHLGKPDCLNDRLSPFTSETCNTYNMLKLTKHLFTWDP
QAAYMDYYERALYNHILASQNPDDGMVCYSVPLESGTKKEFSTRFDSFWCCVASGIENHV
KYAESVFFQSTQDDGLFINLFIPTSLNWREKGMKVKLETQFPADNQVRITFEGKSKKFPL
HIRYPRWATQGIKATLNGKEETVTGTPGSYFTLNDEWGKDTELILDIPMELYTVSMPDNP
NRMGIFYGPVLLAAPLGTEDLQAYEIPCFASDAESIISAIQPVPGKPLAFAANTTANAQL
PLMPFYAIHGQKHAVYFDKFSTQEWTKKEKEYQALIEKQKELEARTTDHLRIGEMQPERD
HDLQAENSNTGDVSGNKYRDAFNGWFSFNVKVDPTKEMQMLCSYWGADKDKRNFDILIDG
KKFKTINLQGTHGPKVFEEEYAIPLSFTQGKEKITVRFQSHPDCHAGGLFGFRMLRKK

Enzyme Prediction     

No EC number prediction in MGYG000000211_04279.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	49	553	3.3e-204	0.9880715705765407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	0.0	43	553	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.91e-133	36	560	9	508	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam16375	DUF4986	9.21e-06	542	617	14	84	Domain of unknown function. This family around 150 residues locates in the C-terminal of some uncharacterized proteins in various Bacteroides and Bacillus species. The function of this family remains unknown.
pfam03663	Glyco_hydro_76	0.009	102	129	222	249	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEM13389.1	6.38e-296	27	778	28	780
QIX60435.1	1.00e-287	16	778	27	791
AEE49143.1	3.59e-265	25	777	34	791
QXV67708.1	8.05e-264	28	776	20	769
AIE84661.1	7.27e-263	31	775	3	748

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	5.69e-173	39	722	28	749	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	3.81e-167	39	722	28	749	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
4QJY_A	3.01e-20	65	551	48	558	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	2.80e-19	65	551	48	558	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000003	0.002508	0.997540	0.000001	0.000001	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000211_04279.