CAZyme Information: MGYG000000211_04281

Basic Information

• Species: Bacteroides sp900556215
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900556215
• CAZyme ID: MGYG000000211_04281
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
969	MGYG000000211_10|CGC4	110322.5	6.8104

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000211	6486320	Isolate	China	Asia

• Gene Location: Start: 141367; End: 144276 Strand: +

Full Sequence      

MKIKLFILFLLAYACNAFAQIKITDRQKSAADFPLHSNGKSCNIQIDAADYEVVNKVAHL
FAEDIERVTGVKGTVSTSKSVQGKEAVIIGTLGHNKFIDELVKKNKLNVSSIENGWEQYV
IKVLDKPFKGVDRALIIAGCDRRGTAYGTFALSEAMGVSPLYWWSDVPTKKQKALYLETS
EYISKTPSIKYRGIFINDEGWGITPWAAKTFEPELGDIGPKTYAKVCELILRMKGNMLAP
AMHPGSGAFNKYPENKVVADSYGIVMTSSHCEPLLFNNVTEWFKDSMGDWNYITNKDGIN
KVLDKRISENSPYENFYTLAMRGIHDSGLVGVTKDNEVKLMEEVLNDQRNILAKHINQDI
DSIPQQFVPYKEVMDIYEKGLKVPDYVTLVWPDDNYGYLKRLSNKNEQKRKGGSGVYYHI
SYCGEPHDYLWINTTTPTLIYEEMRKAYDTGADRYWLLNVGDIKPGELGMKFFLDMAWDV
ESFNFEKTYTYEAEFLASIFGSKYENELSDIFETYYLLAFQHKPESMGWGYEWNNHHDRE
RIIDTDFSFINYNEAENRMEEYDRIADKSEKIWKALPKEYKAAYYELVHYPVKGAALMNK
KMLVAQQNRWYARQGRAATNMLADQVKSYQDSLDYYTDQFNSLLNGKWNHMMSITPGWTG
TYQNMPPIENITVAGEADMQIFIPGQDCTYGMGAVHALPCVNPYTKNNSFIELYNRGSKP
FNWKATTQNNWIKLSRTTGKVSLQDRITVSVDWNKVPQGDDVVGVIELTSGNQTKKVFVP
VFNPASPTVEELKGMYVEDNGCVSINAGKFHRKVENSGIKIRAIKGLGYENDCVQLGEAT
QNVPNMWFTNKSPKAEYDFYTFNGGNATVHVYALPLFPIDSKHDTRYGIMIDDGMVQWMT
TAAKEYSSQWRLNVFRNSAISTINVNVDKPGKHTLKLICADPGMIIQKVVIDFGGMKRSY
LGPNVTYIK

Enzyme Prediction     

No EC number prediction in MGYG000000211_04281.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	32	666	4.7e-231	0.836441893830703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	2.88e-170	185	525	1	333	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	3.65e-49	796	963	2	170	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
cd14948	BACON	5.11e-05	722	779	27	80	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EDV07546.1	0.0	31	969	30	966
ALK86808.1	0.0	23	969	23	967
AYD49386.1	0.0	1	969	1	966
APZ45930.1	0.0	19	969	23	960
AUC19792.1	0.0	19	969	23	960

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZMH_A	2.66e-171	43	964	24	931	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
5BY3_A	2.01e-129	32	656	19	619	Anovel family GH115 4-O-Methyl-alpha-glucuronidase, BtGH115A, with specificity for decorated arabinogalactans [Bacteroides thetaiotaomicron VPI-5482]
6NPS_A	8.47e-122	54	967	32	964	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]
4C90_A	3.00e-114	4	666	14	655	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	6.53e-101	23	653	7	626	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001409	0.833323	0.164413	0.000279	0.000264	0.000247

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000211_04281.