CAZyme Information: MGYG000000211_04313

Basic Information

• Species: Bacteroides sp900556215
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900556215
• CAZyme ID: MGYG000000211_04313
• CAZy Family: GH50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
469	MGYG000000211_10|CGC5	54677.61	7.8418

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000211	6486320	Isolate	China	Asia

• Gene Location: Start: 194877; End: 196286 Strand: -

Full Sequence      

MKIVTILLLSLFASSVLFAQSGKTVQVQTRANSTVENWTPYEAHTVDNLKGFKKKKEPVL
SVFGGYKTNRQEATGFFRTEKINGRWWIIDPEGYPFHHRAVVAFAPGTSEKQQSAFQEKF
GTRAQWVKAETEMLRSYGFNGVGAWSAVEDIRTSQTPLVYTLIVNPMGNYKHEHVKKYRG
AYKVAGWQGYRFNLPMVFDNEFDKYVEQALAPLARYKDDPCLLGYFTDNELPWYTDALDR
HLNFLAKDEQGYLAARKWLDERKGKEATVADITEEDRLAFSAFFFETYMQKVTSVLRRID
PNHMYLGCRFNQDKNQELTNPAIFKVAGKYMDIISINHYRQWQPEQERMNNWGEWSGKPF
LITEWYVKGEDSGLPNATGAGWNVPTQDDRGIFYENFCLQLLRNPYSVGWHWFRYQDNDP
EDLTTDPSNRDSNKGIVDSEYSPWLPLLRRMEKVNKQAYTLTRYFDSQK

Enzyme Prediction     

No EC number prediction in MGYG000000211_04313.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH50	113	460	1.8e-79	0.554364471669219

CDD Domains     

MGYG000000211_04313 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ60241.1	0.0	1	469	1	469
ABQ05111.1	3.16e-236	12	466	14	469
AXB55225.1	3.16e-236	19	469	19	470
AWK02836.1	5.39e-235	19	466	22	470
QDW22820.1	1.60e-233	21	466	22	467

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5T3B_A	1.94e-70	53	466	74	480	ChainA, Glycoside Hydrolase [Phocaeicola plebeius],5T3B_B Chain B, Glycoside Hydrolase [Phocaeicola plebeius]
4BQ2_A	1.16e-28	55	460	239	744	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
5Z6P_A	2.13e-28	56	459	257	759	Thecrystal structure of an agarase, AgWH50C [Agarivorans gilvus],5Z6P_B The crystal structure of an agarase, AgWH50C [Agarivorans gilvus]
4BQ4_A	2.80e-28	55	460	239	744	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ4_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
6XJ9_A	3.27e-24	55	459	258	759	Structureof PfGH50B [Pseudoalteromonas fuliginea],6XJ9_B Structure of PfGH50B [Pseudoalteromonas fuliginea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48840	5.73e-28	58	461	471	951	Beta-agarase B OS=Vibrio sp. (strain JT0107) OX=47913 GN=agaB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000352	0.998919	0.000217	0.000167	0.000159	0.000157

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000211_04313.