CAZyme Information: MGYG000000211_04368

Basic Information

• Species: Bacteroides sp900556215
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900556215
• CAZyme ID: MGYG000000211_04368
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
255	MGYG000000211_11|CGC1	28863.39	8.4356

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000211	6486320	Isolate	China	Asia

• Gene Location: Start: 13503; End: 14270 Strand: -

Full Sequence      

MKRLISAICVLFFLLPLPAQETYQKEIFISSRGDTLQYRLLQPENMKKSEKYPLVLFLHG
AGERGNDNERQLTHGGQMFLNPVNREKYPAFVLAPQCPEMGYWAYSTRPESFLPNEMPLN
EPITPIFQTVKDLLDTYLAMPQVDKSRIYIVGLSMGGMGTFDMAVRFPEIFAAAVPICGT
VNVARLKAAKSVKFRIFHGDADNVVTPEGSRAAYRTLKKAGADVEYIEFPGCNHGSWNPA
FNYPDFMSWLFSQKK

Enzyme Prediction     

No EC number prediction in MGYG000000211_04368.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	33	236	1.3e-27	0.8942731277533039

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4099	COG4099	1.11e-49	24	254	162	386	Predicted peptidase [General function prediction only].
COG1506	DAP2	1.83e-18	28	235	370	595	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
COG0412	DLH	3.84e-13	25	243	3	210	Dienelactone hydrolase [Secondary metabolites biosynthesis, transport and catabolism].
COG3509	LpqC	3.03e-11	31	209	42	208	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
COG0400	YpfH	3.37e-11	53	231	19	186	Predicted esterase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABS60377.1	3.11e-50	36	255	22	245
BCI61582.1	9.33e-46	16	254	804	1042
QJW99051.1	1.94e-34	21	255	32	240
QDU56037.1	1.45e-32	21	255	789	1007
VTR91196.1	2.62e-32	21	255	31	239

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3DOH_A	6.24e-51	16	255	128	380	CrystalStructure of a Thermostable Esterase [Thermotoga maritima],3DOH_B Crystal Structure of a Thermostable Esterase [Thermotoga maritima],3DOI_A Crystal Structure of a Thermostable Esterase complex with paraoxon [Thermotoga maritima],3DOI_B Crystal Structure of a Thermostable Esterase complex with paraoxon [Thermotoga maritima]
3WYD_A	3.49e-25	32	255	17	217	C-terminalesterase domain of LC-Est1 [uncultured organism],3WYD_B C-terminal esterase domain of LC-Est1 [uncultured organism]
4Q82_A	8.31e-11	49	255	77	277	CrystalStructure of Phospholipase/Carboxylesterase from Haliangium ochraceum [Haliangium ochraceum DSM 14365],4Q82_B Crystal Structure of Phospholipase/Carboxylesterase from Haliangium ochraceum [Haliangium ochraceum DSM 14365]
7JIZ_A	2.79e-06	134	239	112	218	ChainA, Dienelactone hydrolase family protein [Solimonas sp. K1W22B-7],7JIZ_B Chain B, Dienelactone hydrolase family protein [Solimonas sp. K1W22B-7]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0J968	2.71e-07	52	250	9	213	Probable carboxylesterase Os04g0669600 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0669600 PE=2 SV=1
Q3UFF7	3.15e-06	55	234	25	212	Lysophospholipase-like protein 1 OS=Mus musculus OX=10090 GN=Lyplal1 PE=1 SV=3
P52090	7.27e-06	129	179	129	179	Poly(3-hydroxyalkanoate) depolymerase C OS=Paucimonas lemoignei OX=29443 GN=phaZ1 PE=3 SV=1
D4AR77	9.42e-06	33	247	385	616	Uncharacterized secreted protein ARB_06907 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_06907 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000380	0.998836	0.000254	0.000158	0.000156	0.000157

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000211_04368.