CAZyme Information: MGYG000000211_04832

Basic Information

• Species: Bacteroides sp900556215
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900556215
• CAZyme ID: MGYG000000211_04832
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
399	MGYG000000211_14|CGC2	45644.28	5.1433

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000211	6486320	Isolate	China	Asia

• Gene Location: Start: 78933; End: 80132 Strand: -

Full Sequence      

MNSKQTLFSLLMCVLALTSCDTQKQATVGNELALTRAKQTLDSLYLNYSVSGTCLLRENY
PSNIGEYTATYLASEEQKNMPNLYSYLWPYSGTFSAVNALFATTGDKEYKSVLDNKVLVG
LEEYFDTRRTPEAYASYINSAPQSDRFYDDNVWLGIDFTDTYMLTKEPKYLQKAQLIWNF
IESGTDDNLGGGIYWCEQRKESKNTCSNAPGSVFALKLFEATKDSAYFVKGQRLYEWTQT
NLQDSTDYLYFDNINLNGKVDKAKFAYNSGQMMQSASLLYQFTGQEKYLTDAQNIAKGCH
NYFFQDYTPENGKPFKLLKKGDVWFIAVMLRGFIELYQADKNGTYLDSFSKSLDYAWGHA
RDEKGLFNTDFSGKTQDNRRWLLTQAAMVEMYARLAAIK

Enzyme Prediction     

EC	3.2.1.101

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	71	376	7.7e-71	0.8379888268156425

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03663	Glyco_hydro_76	6.56e-34	86	306	34	258	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
COG4833	COG4833	5.36e-12	144	270	88	212	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ59939.1	5.21e-296	1	399	1	399
QUT89047.1	2.12e-295	1	399	1	399
QDO71507.1	6.47e-242	1	399	1	399
QGT72765.1	2.06e-238	1	399	1	399
BAD50241.1	1.55e-226	1	399	1	399

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MU9_A	1.22e-101	37	395	8	362	Crystalstructure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482],4MU9_B Crystal structure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482]
6U4Z_A	7.43e-69	87	396	169	492	CrystalStructure of a family 76 glycoside hydrolase from a bovine Bacteroides thetaiotaomicron strain [Bacteroides thetaiotaomicron]
4C1S_A	9.00e-68	87	399	45	371	Glycosidehydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],4C1S_B Glycoside hydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]
4V1S_A	2.11e-30	2	399	6	391	Structureof the GH76 alpha-mannanase BT2949 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],4V1S_B Structure of the GH76 alpha-mannanase BT2949 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4V1R_A	8.97e-28	2	378	6	368	Structureof a selenomethionine derivative of the GH76 alpha- mannanase BT2949 Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],4V1R_B Structure of a selenomethionine derivative of the GH76 alpha- mannanase BT2949 Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5ACZ2	2.23e-06	170	304	144	291	Mannan endo-1,6-alpha-mannosidase DFG5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DFG5 PE=1 SV=1
O14131	9.04e-06	145	295	100	264	Meiotically up-regulated gene 191 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug191 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000082	0.999987	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000211_04832.