CAZyme Information: MGYG000000212_01913

Basic Information

• Species: Blautia_A obeum
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia_A; Blautia_A obeum
• CAZyme ID: MGYG000000212_01913
• CAZy Family: GT4
• CAZyme Description: Putative glycosyltransferase EpsF

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
370	MGYG000000212_4|CGC1	42921.53	8.4057

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000212	3683307	Isolate	China	Asia

• Gene Location: Start: 96757; End: 97869 Strand: -

Full Sequence      

MYKVLVFGITENPGGVESFLVNYYRKIDRTKIQFDFLCNTHNEVAYENELKSLGGQVVHI
AMRSKEPMKYRKELKEFMEKHASDYQAVWVNVCSLANIDYLKIAKKYGIKKRIIHSHNSQ
NMDNRIRMFLHMINRQRISDYATDFWACSEDAAKWFYKEDLQSKAVIIKNAIELDRVGFS
EEKREVIRNKYGISDKLVLGNVGRLHFQKNQLFALDIMKYFSQKNPNCVLMLVGQGEDEK
KLHQRAEELNIKEKIIFAGVQSDIGAYLSAFDIFLFPSVFEGLSIAGLEAQVNGLPVLAS
YGVIPKEVKLTENFHFKKLEDGAKSWAEEIEKLSLELKRTDKNEIEKQFTEAGFNIDTEV
KRLEKLLMEK

Enzyme Prediction     

EC	2.4.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	196	333	8.9e-27	0.86875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03812	GT4_CapH-like	4.75e-115	3	364	1	357	capsular polysaccharide biosynthesis glycosyltransferase CapH and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. capH in Staphylococcus aureus has been shown to be required for the biosynthesis of the type 1 capsular polysaccharide (CP1).
cd03811	GT4_GT28_WabH-like	1.05e-36	3	308	1	300	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
cd03807	GT4_WbnK-like	1.24e-35	12	300	10	294	Shigella dysenteriae WbnK and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. WbnK in Shigella dysenteriae has been shown to be involved in the type 7 O-antigen biosynthesis.
cd03801	GT4_PimA-like	9.31e-32	3	367	1	365	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03817	GT4_UGDG-like	5.44e-30	101	369	101	371	UDP-Glc:1,2-diacylglycerol 3-a-glucosyltransferase and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. UDP-glucose-diacylglycerol glucosyltransferase (EC 2.4.1.337, UGDG; also known as 1,2-diacylglycerol 3-glucosyltransferase) catalyzes the transfer of glucose from UDP-glucose to 1,2-diacylglycerol forming 3-D-glucosyl-1,2-diacylglycerol.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTE73679.1	8.05e-154	1	370	5	373
VEF35766.1	8.58e-148	1	365	1	364
QCU01252.1	7.58e-143	1	368	1	368
ACR76356.1	3.30e-140	1	364	7	369
AZN77304.1	4.90e-139	1	367	1	365

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6N1X_A	5.25e-06	179	309	182	313	ChainA, Glycosyltransferase [Staphylococcus aureus subsp. aureus CN1]
6D9T_A	5.50e-06	179	309	198	329	BshAfrom Staphylococcus aureus complexed with UDP [Staphylococcus aureus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P71055	4.45e-38	12	306	16	314	Putative glycosyltransferase EpsF OS=Bacillus subtilis (strain 168) OX=224308 GN=epsF PE=2 SV=1
Q58459	8.87e-15	159	300	165	306	Uncharacterized glycosyltransferase MJ1059 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1059 PE=3 SV=1
Q04975	7.95e-12	199	300	401	502	Vi polysaccharide biosynthesis protein VipC/TviE OS=Salmonella typhi OX=90370 GN=vipC PE=4 SV=2
P39857	6.26e-11	1	370	1	353	Capsular polysaccharide biosynthesis glycosyltransferase CapH OS=Staphylococcus aureus OX=1280 GN=capH PE=3 SV=1
O05083	1.11e-10	188	299	173	284	Uncharacterized glycosyltransferase HI_1698 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1698 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000212_01913.