CAZyme Information: MGYG000000213_03224

Basic Information

• Species: Blautia_A sp003477525
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia_A; Blautia_A sp003477525
• CAZyme ID: MGYG000000213_03224
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
834	MGYG000000213_46|CGC2	96200.49	5.7262

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000213	4347192	Isolate	China	Asia

• Gene Location: Start: 16403; End: 18907 Strand: +

Full Sequence      

MGKIFWSVDEKKYNDQSAHTLILSGWAADTEERKECELLLYGDGEELPALKISRHYRADV
AKKLTELGEVNAGFRAEIPEIPELAGKYAELELFVVNGGEKVSIWKETTRELKEFCADCL
MEYKIDREQIMGKNTLMIDGWVLDQRGEAEIRVEDESGRPVNCTITRVRRPDVEEERNIH
TEKKPELGFSISVNLEEITAREITILFCGPETKKTYTVNIKKLKAENSVFHQMRRVLAWE
NREKNAAYIRENGLGQFVRYLGSHQQEGAVLDYEEWLKDHAAGRKELKRQRNAVFSYMPL
ISIVIPLYNTPQEYLKEIVDSVIAQTYGNWQLCLADGSEGEETGEFLRKKYKKEIRISYK
KLKENKGISENTNAAIKLAMGDYIMLCDHDDVLAPDALFHIVKAITEKKADVVYTDEDKV
SMDGKHYFEPNFKPDFNLFRLRENNYICHIFAVKKELLEQVGTFRSEYDGAQDFDLIFRC
CEQAKQIVHVPRVLYHWRSHMNSTAANPESKRYAFEAGRRAIEAHYKRMGIPAAVEMTER
PGWYRSHVEIQGEPLISIIIPNKDHIDDLELCISSVEERSTWKNYEILVVENNSENKETF
AYYEALKGRYDNVRILTWKKEFNYSSINNFAVKEARGEYLLFLNNDVEIITPSWIEEMLQ
NCQQDGVGITGAKLYYPDDTIQHAGVVVGLGGIAGHIMCKAPRETVGYMGRMVCVQEMSA
VTAACMLVKASVFREVGGFDEELKVAFNDIDFCMKVRSVGQKVVFTPYAELYHYESKSRG
LEDTPEKQQRFSREVKCFRRKWERELLKGDPYYSPNLSLKEGDCSLRKAERNGD

Enzyme Prediction     

No EC number prediction in MGYG000000213_03224.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	302	446	6.2e-28	0.9
GT2	557	681	1.6e-20	0.7176470588235294

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	9.32e-97	299	498	1	201	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	1.13e-39	558	775	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	8.44e-27	552	780	1	226	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	7.56e-26	302	458	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd06433	GT_2_WfgS_like	2.37e-25	302	500	1	196	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL24562.1	0.0	1	828	1	811
CBL36811.1	1.11e-241	121	833	1	719
CBK76130.1	1.11e-241	121	833	1	719
QRV18616.1	1.68e-241	121	827	1	715
ADL03204.1	1.68e-241	121	827	1	715

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	9.20e-11	300	453	6	147	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]
1H7L_A	3.82e-08	299	467	1	181	dTDP-MAGNESIUMCOMPLEX OF SPSA FROM BACILLUS SUBTILIS [Bacillus subtilis],1H7Q_A dTDP-MANGANESE COMPLEX OF SPSA FROM BACILLUS SUBTILIS [Bacillus subtilis],1QG8_A Native (Magnesium-Containing) Spsa From Bacillus Subtilis [Bacillus subtilis],1QGQ_A Udp-manganese Complex Of Spsa From Bacillus Subtilis [Bacillus subtilis],1QGS_A Udp-Magnesium Complex Of Spsa From Bacillus Subtilis [Bacillus subtilis]
5TZE_C	7.37e-06	302	509	4	219	Crystalstructure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZE_E Crystal structure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZI_C Crystal structure of S. aureus TarS 1-349 [Staphylococcus aureus],5TZJ_A Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZJ_C Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZK_C Crystal structure of S. aureus TarS 1-349 in complex with UDP [Staphylococcus aureus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	3.06e-145	299	826	366	897	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	9.13e-100	266	834	286	848	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q9ZDI9	3.12e-13	297	479	6	192	Uncharacterized glycosyltransferase RP339 OS=Rickettsia prowazekii (strain Madrid E) OX=272947 GN=RP339 PE=3 SV=1
Q68X33	7.54e-13	296	479	5	192	Uncharacterized glycosyltransferase RT0329 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) OX=257363 GN=RT0329 PE=3 SV=1
A0A0H2UR96	2.01e-12	300	428	4	132	Glycosyltransferase GlyG OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyG PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000213_03224.