CAZyme Information: MGYG000000213_03660

Basic Information

• Species: Blautia_A sp003477525
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia_A; Blautia_A sp003477525
• CAZyme ID: MGYG000000213_03660
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
390		44300.84	9.5159

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000213	4347192	Isolate	China	Asia

• Gene Location: Start: 5391; End: 6563 Strand: +

Full Sequence      

MRIPQNQIDLLQDISKVNENIIGILSAGSAIEMPWHTCCKAILHGYLNGQAGASATLDIL
TGKVNPSGRLAETYPISYEQTPAFRYYPSNEKTSEYRESVYVGYRYYDTSKVRVQYPFGF
GLSYTEFTYSDLIIEEDGIKVSVTNTGDRDGAEVVQMYVGLPNAIVFRPEKELKGFAKVY
LKAGESRQLRIPFDDKTFRYWNIKTGQWEIETGTYQIMVGASVADIRLTGMTERTGNSKG
YPYNPAKMPYYYTGIVQKISDEEFRELLGHEIPNRRWSGNLEINDAICQMYYAKSRLARL
IYRCLTKMKKKSEAQGKPDLNILFIYNMPFRGIAKMTGGAVSMEMVYGIVDAVNGHFMLG
VKKVVGGYFRNRRNNKKYEKLLKGAGGKCR

Enzyme Prediction     

No EC number prediction in MGYG000000213_03660.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	3.08e-42	1	227	525	758	beta-glucosidase BglX.
pfam14310	Fn3-like	1.18e-30	153	222	1	70	Fibronectin type III-like domain. This domain has a fibronectin type III-like structure. It is often found in association with pfam00933 and pfam01915. Its function is unknown.
pfam01915	Glyco_hydro_3_C	3.10e-24	1	124	114	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
PLN03080	PLN03080	3.99e-18	3	220	513	769	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL23364.1	7.52e-276	1	390	431	820
QCU02383.1	1.90e-271	1	390	431	820
QBE98345.1	7.94e-201	1	387	423	809
QQR02742.1	8.70e-185	1	384	427	810
ANU50590.1	8.70e-185	1	384	427	810

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	1.11e-56	1	354	427	752	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	4.88e-54	3	242	426	671	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	9.73e-41	1	227	586	821	CrystalStructure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]
3AC0_A	6.89e-37	1	226	597	828	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.71e-36	3	226	599	828	Crystalstructure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	3.17e-56	1	354	427	752	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	4.49e-50	3	242	435	680	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	1.17e-49	3	242	435	680	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
A7LXS8	7.90e-43	3	229	502	740	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
P27034	1.76e-41	1	227	566	803	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000213_03660.