CAZyme Information: MGYG000000214_01383

Basic Information

• Species: Veillonella dispar_A
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Veillonellaceae; Veillonella; Veillonella dispar_A
• CAZyme ID: MGYG000000214_01383
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
538	MGYG000000214_31|CGC1	61188.21	9.496

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000214	2032518	Isolate	China	Asia

• Gene Location: Start: 14409; End: 16025 Strand: +

Full Sequence      

MINNHMLRIGALFLLTVLSYGFYNAFLPITDPVESNYVLSAITMLKHNSWISPMIYDQVW
YDKPPLTYWALMISYKLFGISDFTSRIPNTLIAGGSVALMYHLVYRIKESKHIAVMSALL
LFSALQFWYISHAVITDGFLFFFSLAIFGYSYLGFAKNDKYSIVKAYGAAALAVVTKGPV
GIVLPGLILLLFIAIRWFTKKDNDDYSLDKDIKLLFNPFGIFLFIILASPWYIAMYSIHG
QEFISGFLGLHNMERALVSEHPKFNVWYYYLIIVPLALLPWTPAVIYRLKSIKWKNDFYL
IGAIWFIIIVLFYSLVATKYITYTLPAIIPCIIWGAEAITSSFNNKANSFKYIVTIPLGI
YTVLFVTASIATPELNPIPLIIALITIVLFTLLAKQYRNKKLPLSICLATPLIILYTAIT
ITVTPILYDQSGLQFKPYIKSNTQHTYIYGTYYTSILYYTENTPTQVFVHTTDNPLWTAG
KTLMPTITLEEFDRRVSAEKGAIIIVPNKYSKEFTNSPTNIIATEVGKNGSSRIYQIQ

Enzyme Prediction     

No EC number prediction in MGYG000000214_01383.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	8	414	5.3e-77	0.7648148148148148

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	3.27e-38	6	423	7	429	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	2.13e-14	6	345	2	339	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	6.09e-09	62	201	1	141	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
COG4745	COG4745	0.004	47	177	45	177	Predicted membrane-bound mannosyltransferase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBU36964.1	0.0	1	538	1	538
VEG94157.1	0.0	1	538	1	538
SNV73216.1	6.10e-273	1	538	1	538
CAB1276937.1	6.14e-256	1	538	1	546
QQB17357.1	5.81e-254	1	538	1	546

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	7.15e-13	29	328	54	353	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67270	3.36e-28	6	353	1	335	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
O67601	4.34e-23	12	328	5	299	Uncharacterized protein aq_1704 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1704 PE=3 SV=1
B4EUL1	1.05e-15	13	360	15	357	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Proteus mirabilis (strain HI4320) OX=529507 GN=arnT1 PE=3 SV=1
Q3KCB9	1.77e-14	7	364	9	359	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=arnT2 PE=3 SV=1
B2VBI7	5.53e-14	31	371	29	366	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99) OX=465817 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	29
112	131
138	156
171	193
214	236
266	285
298	317
321	343
350	372
377	394
406	428