CAZyme Information: MGYG000000215_02274

Basic Information

• Species: Prevotella stercorea
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella stercorea
• CAZyme ID: MGYG000000215_02274
• CAZy Family: GH85
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1275	MGYG000000215_62|CGC1	141273.03	5.7084

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000215	3117648	Isolate	China	Asia

• Gene Location: Start: 6740; End: 10567 Strand: -

Full Sequence      

MNNKKTTLLASMLLCGCVFGYAQRTPTHPLDIQDKGDQYLLENIWNWEAGTPPREVSEMD
DQFYISRVRPLPRIAEADDYQAEVSKQAKPGRKMCLWTPLDDPTSSWKALPRYCFEGDNF
SMWSYLNIHGNWTAPWFRVTGGLSDVAHKNGVAVGCVASIPWNANVNLYAASGWGKTFGE
LTKKNSDGTYKNVERFVKILKYYGIDGVGVNSEFNASAATMKQIRGFFAECHKEAEKIGW
KFQLHWYDGTNDYGGITFDQGLGAHNKAQFGDKDNIVTDMMFSNYNTGGGTLKNTAAYAK
SLGRDPYDYYKGFDIQGRALHASSSNWNDLNDVEASVGFWGAHSQGLIHQSATDYGTSDV
AIQQAYLDKQEMVFSGGNRNPANTPDILGWSDVVTLANGSLKGKFHGVASYVTAKSTIQQ
VPFVTRFNLGNGLTFKNEGEVAFNHKWHNIATQDFLPTWRWWIVDGNESAKNGNLAQAEL
TWDDAYWGGSCLRLKGQTTTSRVKLFKTLLKTEPSYNISLTYKMSNELDTHAKLFVALKG
KLTEYKEIAIPAAEKFGQWTTFTTTLDKLGLKSGDEIAMIGIRLDNTAKDYNMLVGELAV
RNPQQKFAPVAPKIKEIEVLRGKDKTCDFKIRYAAKEETGGVKTYNDEVDTWYYEIWFQQ
KGEKEQYLTATTSWAAYVIDAPMVADLEKRDCRFGVRAVSPDGQQKSEISWSEYQTVEYD
TPSTEVAIDRQVIKPNEQFKVYYEDQFAPNAQSFRLLNAQTGAQVGEKYSNCNQFTTSVA
EVGVYDLEVVNDKGAKEIFRGKVIISPEKTGAVPVVETVTADKQTAETTEEIKLNYTSRD
GEGKVSRGLVVKDPNMLLIPAEVTLDGGNNTSMAYSYALWVKVDNYAHDKQGTNLIQKNT
ISDRWPHNNWGDLWVQVRPQINAGEHDCNSNHLANEVSFNTFGWTAHDNPRESMMSTGYA
LNPGVWNHIVVTQSSDKQQKIYFNGKCVAGPNNFSSSSLRENSTDNRINTSEHANVFIGG
GGVYKAGLNATIDEVQVWNKPLTDAEVVRAMQGYAANEVPEGLMGYYTFEEMDKSDSTFV
NLGKAGAQYKARMVVMAGSGGENTSTASYKTVGANNEVTGYPGIDGTLEVKTSHTWQLNG
GRISSETDKAAVVTFARPGEYEAGVKLTNFWGESEKALENVLVITGVDAINDVKDAAGFS
VYPNPFVESVNLRFAEGGFYTINIVSAAGAVLQSNDFRADAGETVNVAVQGGKGMYIVQV
LKDGKPFKALNVIKK

Enzyme Prediction     

No EC number prediction in MGYG000000215_02274.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH85	115	435	7.1e-59	0.9428571428571428

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4724	COG4724	1.52e-51	42	602	37	551	Endo-beta-N-acetylglucosaminidase D [Carbohydrate transport and metabolism].
pfam03644	Glyco_hydro_85	1.64e-31	115	432	5	291	Glycosyl hydrolase family 85. Family of endo-beta-N-acetylglucosaminidases. These enzymes work on a broad spectrum of substrates.
cd06547	GH85_ENGase	1.97e-31	119	467	26	339	Endo-beta-N-acetylglucosaminidase (ENGase) hydrolyzes the N-N'-diacetylchitobiosyl core of N-glycosylproteins. The beta-1,4-glycosyl bond located between two N-acetylglucosamine residues is hydrolyzed such that N-acetylglucosamine 1 remains with the protein and N-acetylglucosamine 2 forms the reducing end of the released glycan. ENGase is a key enzyme in the processing of free oligosaccharides in the cytosol of eukaryotes. Oligosaccharides formed in the lumen of the endoplasmic reticulum are transported into the cytosol where they are catabolized by cytosolic ENGases and other enzymes, possibly to maximize the reutilization of the component sugars. ENGases have an eight-stranded alpha/beta barrel topology and are classified as a family 85 glycosyl hydrolase (GH85) domain. The GH85 ENGases are sequence-similar to the family 18 glycosyl hydrolases, also known as GH18 chitinases. An ENGase-like protein is also found in bacteria and is included in this alignment model.
pfam13385	Laminin_G_3	2.41e-12	863	1047	7	150	Concanavalin A-like lectin/glucanases superfamily. This domain belongs to the Concanavalin A-like lectin/glucanases superfamily.
TIGR04183	Por_Secre_tail	3.15e-04	1201	1275	1	72	Por secretion system C-terminal sorting domain. Species that include Porphyromonas gingivalis, Fibrobacter succinogenes, Flavobacterium johnsoniae, Cytophaga hutchinsonii, Gramella forsetii, Prevotella intermedia, and Salinibacter ruber average twenty or more copies of a C-terminal domain, represented by this model, associated with sorting to the outer membrane and covalent modification.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGB28385.1	0.0	14	1275	5	1258
QUB76736.1	0.0	4	1275	2	1259
QUB82359.1	0.0	4	1275	2	1259
QUB72359.1	0.0	4	1275	2	1259
QUB42054.1	0.0	4	1275	2	1255

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FHQ_A	4.08e-42	39	700	11	603	ChainA, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHQ_B Chain B, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHQ_D Chain D, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHQ_F Chain F, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae]
3FHA_A	1.76e-41	39	700	11	603	ChainA, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_B Chain B, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_C Chain C, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_D Chain D, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae]
2VTF_A	3.46e-40	39	700	16	608	X-raycrystal structure of the Endo-beta-N-acetylglucosaminidase from Arthrobacter protophormiae E173Q mutant reveals a TIM barrel catalytic domain and two ancillary domains [Glutamicibacter protophormiae],2VTF_B X-ray crystal structure of the Endo-beta-N-acetylglucosaminidase from Arthrobacter protophormiae E173Q mutant reveals a TIM barrel catalytic domain and two ancillary domains [Glutamicibacter protophormiae]
2W91_A	2.70e-37	115	703	80	622	Structureof a Streptococcus pneumoniae family 85 glycoside hydrolase, Endo-D. [Streptococcus pneumoniae TIGR4],2W92_A Structure of a Streptococcus pneumoniae family 85 glycoside hydrolase, Endo-D, in complex with NAG-thiazoline. [Streptococcus pneumoniae TIGR4]
3GDB_A	1.27e-36	115	703	231	773	Crystalstructure of Spr0440 glycoside hydrolase domain, Endo-D from Streptococcus pneumoniae R6 [Streptococcus pneumoniae R6]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002570	0.558289	0.437283	0.000709	0.000625	0.000481

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000215_02274.