CAZyme Information: MGYG000000216_00791

Basic Information

• Species: Blautia_A sp003474435
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia_A; Blautia_A sp003474435
• CAZyme ID: MGYG000000216_00791
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
543		62249.12	4.5666

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000216	3676052	Isolate	China	Asia

• Gene Location: Start: 47850; End: 49481 Strand: +

Full Sequence      

MQEKYLEFKLGAPDYVTVETEEERLVCQGGSSAVTAGSTTVEFEDAGEHEDIFVTSEDAV
KCVKLRWNYKIPKSARFFGDAWERTYGDMEWHGMSGNRYLPWYFLAKLSEKILCFGVKVR
PSAMCYWQADTKGITLFLDVRCGNAGVQLKGRKLRAAQIVCMESQNAGSFETAQEFCRRM
CTDPIFPEFPVYGSNNWYYAYGDSSEEEILSDTDYILKLTEGVKNPPFMVIDDCWQEHHR
LDEYNGGPWTKGNSKFPDMKGLAQKLVEKGVRPGIWVRLLLNEDEAIPDEWRISYNDCLD
PSHPDALAYIRKDIERICDWGFTLIKHDFSTFDLFGKWGFEANLRDNTMEKWHFYDQGKT
SAEIVKMLYQEVYDASRGNNAVIIGCNTIGHLGAGLMHLNRTGDDTSGRIWERTKRMGVN
TLAFRLPQHNTFYHIDADCVGIFGKIPWDKNLQWADLLAKSGTPLFVSAMPGALNPEEFE
ELHQIMLIASEQKEHFVPLDWEETDCPEIWGENGETVTYDWYDDEGPTMDATVEYYNAKV
VVP

Enzyme Prediction     

No EC number prediction in MGYG000000216_00791.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	4.57e-42	190	484	2	292	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd14792	GH27	1.44e-09	190	329	1	124	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
COG3345	GalA	4.56e-07	159	329	259	451	Alpha-galactosidase [Carbohydrate transport and metabolism].
pfam02065	Melibiase	5.04e-06	195	310	46	171	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
cd06592	GH31_NET37	1.49e-04	190	312	3	111	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL19648.1	0.0	1	543	19	561
QCU01578.1	0.0	1	543	19	561
SNU96820.1	8.30e-255	13	526	11	527
BDA09953.1	1.93e-249	9	526	7	530
QIB59833.1	1.05e-246	9	526	7	530

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000216_00791.