CAZyme Information: MGYG000000217_01150

Basic Information

• Species: Acetatifactor sp900066565
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Acetatifactor; Acetatifactor sp900066565
• CAZyme ID: MGYG000000217_01150
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
358	MGYG000000217_5|CGC3	41082.73	4.7292

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000217	3653823	Isolate	China	Asia

• Gene Location: Start: 94999; End: 96075 Strand: +

Full Sequence      

MEKRPLDYAKASMDTMMRKWEAPKLPPEGRFHYHQGVFLSGMYKSYELCKEEKYFDYIKS
WVDAVITEDGVIKQADMGQFDDMQPGILLYPLYHCTGDARYKKALDSLMAAIDCYPTTPE
GGYFHKADLPEEMWLDGLYMEGPLRAQYGAEFHHPEYFDEVIFQALTMQKHTRDPKTGLL
YHAWSYDRKVEWADKETGCSPEFWGRAMGWVPVALLDELDFIPADHPDRAKLEKMAVDLL
KSLLAFQSEDGRWYQVVNRGDDPANWLENSCSCLYVAALCKAIRKGLLDASYLEYARKGY
EGVIRSLTWEGDDLIIGNVCIGTGVGDYDHYIHRPVSANDLHGVGAFLLMCEECEQVF

Enzyme Prediction     

No EC number prediction in MGYG000000217_01150.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	26	355	6e-104	0.9728915662650602

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	2.87e-109	3	358	6	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	1.42e-102	8	355	1	340	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ92567.1	7.74e-160	1	353	1	354
QNK55786.1	1.75e-145	5	353	10	359
AFC29184.1	1.94e-145	5	356	10	362
AEI40556.1	7.87e-145	5	356	10	362
AFH61356.1	1.58e-144	5	353	10	359

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1NC5_A	6.01e-112	3	358	11	368	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	2.48e-111	3	358	1	358	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
4WU0_A	6.57e-75	8	355	4	359	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
3QWT_A	8.82e-27	31	358	65	381	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	3.29e-111	3	358	11	368	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	2.07e-21	143	353	4	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	2.07e-21	143	353	4	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000217_01150.