CAZyme Information: MGYG000000217_02632

Basic Information

• Species: Acetatifactor sp900066565
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Acetatifactor; Acetatifactor sp900066565
• CAZyme ID: MGYG000000217_02632
• CAZy Family: GH4
• CAZyme Description: Alpha-galacturonidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
162	MGYG000000217_19|CGC2	17460.84	4.4008

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000217	3653823	Isolate	China	Asia

• Gene Location: Start: 59995; End: 60483 Strand: -

Full Sequence      

MEYADGKVKDLQIAYIGGGSRGWAWTFMTDLAMDEELSGTIRLYDIDAEAAKHNEIIGNR
LSAREDVVGKWNYTVSDSLQSALTGADFVVISILPGTFDEMAVDVHMPERLGIYQSVGDT
AGPGGAMRALRTIPMYVEIAQAIRAYAPKPGSSITPTPCPCA

Enzyme Prediction     

No EC number prediction in MGYG000000217_02632.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH4	13	149	9.8e-38	0.7430167597765364

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd05297	GH4_alpha_glucosidase_galactosidase	5.80e-58	11	149	1	138	Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases. linked to 3D####ucture
pfam02056	Glyco_hydro_4	2.32e-36	12	149	1	137	Family 4 glycosyl hydrolase.
COG1486	CelF	2.42e-35	9	149	2	139	Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolase [Carbohydrate transport and metabolism].
PRK15076	PRK15076	1.35e-27	12	148	3	139	alpha-galactosidase; Provisional
cd05296	GH4_P_beta_glucosidase	1.13e-15	11	149	1	137	Glycoside Hydrolases Family 4; Phospho-beta-glucosidase. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by the GH4 glycoside hydrolases such as the phospho-beta-glucosidases. Other organisms (such as archaea and Thermotoga maritima ) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. The 6-phospho-beta-glucosidase from Thermotoga maritima hydrolylzes cellobiose 6-phosphate (6P) into glucose-6P and glucose, in an NAD+ and Mn2+ dependent fashion. The Escherichia coli 6-phospho-beta-glucosidase (also called celF) hydrolyzes a variety of phospho-beta-glucosides including cellobiose-6P, salicin-6P, arbutin-6P, and gentobiose-6P. Phospho-beta-glucosidases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABX43749.1	2.55e-76	1	149	1	149
QOV18776.1	7.19e-76	1	148	1	148
QJU19660.1	1.43e-75	1	149	1	149
QRP39116.1	2.03e-75	1	149	1	149
ASN96107.1	2.03e-75	1	149	1	149

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FEF_A	1.17e-50	7	149	2	139	Crystalstructure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_B Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_C Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_D Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis]
1S6Y_A	4.00e-07	4	139	1	135	2.3Acrystal structure of phospho-beta-glucosidase [Geobacillus stearothermophilus]
5C3M_A	5.42e-07	9	148	3	141	Crystalstructure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_B Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_C Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_D Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A9KTB9	5.11e-77	1	149	1	149	Alpha-galacturonidase OS=Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) OX=357809 GN=Cphy_3396 PE=1 SV=1
I3VRU1	3.38e-68	1	148	1	148	Alpha-galacturonidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=Tsac_0200 PE=1 SV=1
D3T426	5.70e-60	1	149	1	143	Alpha-galacturonidase OS=Thermoanaerobacter italicus (strain DSM 9252 / Ab9) OX=580331 GN=Thit_1733 PE=1 SV=1
P39130	5.04e-52	11	149	10	143	Alpha-galacturonidase OS=Bacillus subtilis (strain 168) OX=224308 GN=lplD PE=1 SV=2
P30877	1.88e-13	12	149	6	143	Alpha-galactosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=melA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000217_02632.