CAZyme Information: MGYG000000217_03320

Basic Information

• Species: Acetatifactor sp900066565
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Acetatifactor; Acetatifactor sp900066565
• CAZyme ID: MGYG000000217_03320
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
688	MGYG000000217_33|CGC1	78752.68	6.2938

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000217	3653823	Isolate	China	Asia

• Gene Location: Start: 14013; End: 16079 Strand: -

Full Sequence      

MSESNTEINYKEAYEREHEKCADLADKIVVLESEKEDLQFKLDRIKKNKFWKATGPARSV
IHFAQRQKERLSHCGGPKDILRKIRNKSHQKSLMESYGTGSFPDAEQRKNEEETVFPYMP
KISILVPLWNNKREFQIQMLDCVMNQTYQNWELCLADGSDAEHAYIEELCKEYAAKSDGR
IVYKHLDHNGGISYNTNECYKLATGDYIGLFDQDDILHPSVLYAYVKEINEQGADYLYCD
ETTFQEDNINKMLTMHFKPDYAPDNLRANNYICHFSVFSRKLLEGEELFRTAFDGAQDHD
MILRLTDRAQKIVHVPRLMYYWRSHAGSTAASIDAKPYAIEAAKGAVADHLKKHGFKHFQ
ITSTRACATIFRIRYQILGDPKISIVIANKDHVEDLKRCITSIQKNSTWSNYEIIVVENN
STTPEIRDYYSQLLALSGNDSYAERCKLHTVCGHDGGILHSEDGRISVVTYHGDFNYSAV
NNLGVSYATGDYILLLNNDTEVITANWMEEMLMYAQREDVGAVGAKLYYADKTIQHAGVV
IGLGAHRTAGHTHYRIPVQNLGYMGRLCYTQNATAVTGACLLVKKSLYEQVGGLDESFVI
SLNDVDFCLKLRKLGLLNVWTPFAELYHYESISRGLDDQGEKAERYNKESEHFREKWKAE
LEAGDPYYNPNFSLDRSDYALRDPVSGR

Enzyme Prediction     

No EC number prediction in MGYG000000217_03320.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	123	283	3.9e-20	0.9705882352941176
GT2	384	590	2.5e-16	0.9823529411764705

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	1.21e-74	120	323	1	201	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	6.48e-36	385	630	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	6.77e-29	381	635	3	226	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	5.30e-18	123	283	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	3.27e-16	124	275	1	155	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM02106.1	0.0	6	688	2	685
ADL33299.1	1.54e-307	6	681	2	671
AOZ95572.1	5.59e-301	6	681	2	673
QUO22278.1	5.89e-275	41	682	17	629
CAB1243278.1	2.62e-219	9	683	384	1034

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	2.08e-124	120	684	366	900	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	2.89e-78	120	682	319	841	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
P77414	4.47e-14	120	315	5	207	Putative colanic acid biosynthesis glycosyl transferase WcaA OS=Escherichia coli (strain K12) OX=83333 GN=wcaA PE=4 SV=1
A0A0H2UR96	2.19e-11	122	328	5	220	Glycosyltransferase GlyG OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyG PE=1 SV=1
P9WMY2	7.91e-09	576	637	183	244	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=wbbL PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000031	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000217_03320.