CAZyme Information: MGYG000000218_01300

Basic Information

• Species: Acidaminococcus provencensis
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Acidaminococcus; Acidaminococcus provencensis
• CAZyme ID: MGYG000000218_01300
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
545		61938.69	9.7609

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000218	2599623	Isolate	China	Asia

• Gene Location: Start: 63947; End: 65584 Strand: -

Full Sequence      

MKKKYWICFWAAAIFLLFFLNGSLPLTDSVEGNYALTAKEMVLSGDYLSPQIYGRYWFDK
PVFSYWMIALGFKIFGFSEFGARFFPSLFGLGGLGLTVWAGKKLYSEETAFMSGLLLMMT
LEFFTISKSVLTDGMLFLFLNGALVFFYLGYSTKEKSYYYGTYLLAGLATLTKGPIGFLM
PGLIIVLFLLWRRDAKCLQRAKLPSGILLFLLVTAPWYVAMIHYHPDFLASFIGTHNFLR
ATVSEHPRDNVIYYYTAVNLLNAYAWVGFVPGMLWNLLRKQGHWVKPAAKEGFLLIWMVT
IFVFFQCMATKYITYTYPLLLPLCLLTGSYIVKKGRSLTMKWMLLGNVLFYGALSVAAYQ
LPKLAPGVVPGSRNVFFFMLIYCACMVVLGVHKYRGKSNQEVWTTVIMLTIVFHCCILEL
LAKPLMYDVSGKPSAQFISQYVPENVPIYVRGGGYPTSGVFYTGREMVMLVPDDEAADFA
PKEGSWSAKNIMPWTTFSQVKDKSQAVVLVDTKTKKIKNKVEVDWPGVWKKVKLPGQWMV
MIKEK

Enzyme Prediction     

No EC number prediction in MGYG000000218_01300.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	3	518	9.4e-106	0.9666666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	3.98e-48	1	447	6	456	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	9.01e-29	1	315	3	317	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	2.02e-18	59	217	1	157	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	7.12e-08	34	228	35	241	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADB46704.1	4.22e-312	1	545	1	546
AEQ23377.1	4.24e-279	1	545	1	545
QTV78033.1	5.48e-144	1	499	1	488
AVO74995.1	8.63e-109	16	543	38	508
CCC74317.1	8.63e-109	16	543	38	508

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	2.79e-32	6	449	33	484	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0KGY4	7.63e-33	10	341	6	343	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=arnT PE=3 SV=1
A4SQX1	4.74e-32	10	366	6	367	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas salmonicida (strain A449) OX=382245 GN=arnT PE=3 SV=1
A8FRR0	1.73e-27	22	443	25	444	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Shewanella sediminis (strain HAW-EB3) OX=425104 GN=arnT PE=3 SV=1
Q4K884	2.17e-27	10	386	38	420	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=arnT2 PE=3 SV=1
Q66A06	2.61e-26	11	407	9	391	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) OX=273123 GN=arnT PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.903978	0.092995	0.002231	0.000212	0.000175	0.000438

TMHMM  Annotations     

start	end
5	27
61	78
80	99
109	131
136	153
168	190
203	225
256	278
291	308
313	332
344	361
374	391
403	422